KEGG   Segniliparus rotundus: Srot_0508Help
Entry
Srot_0508         CDS       T01238                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srt  Segniliparus rotundus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Srot_0508
   00052 Galactose metabolism
    Srot_0508
   00500 Starch and sucrose metabolism
    Srot_0508
   00520 Amino sugar and nucleotide sugar metabolism
    Srot_0508
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Srot_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486798..487781)
Genome map
AA seq 327 aa AA seqDB search
MAENENSLSTLPRPGMPHTAVVPAAGMGTRFLPVTKSVPKELLPVVDTPGIELVAAEAAQ
AGAQRLVIVTSEGKDSVVAHFVEDLVLESALEAKGKSAMLEKVRRAPKLIKVESVIQHQP
LGLGHAIAQVEPLLHPDDDAIAVLLPDDLVLKSPQQVAQERERDICDQIEIREKVGALNL
MAQVRAEHGGSVICAFPVPREEISAYGVFDVVEQEGPVRRVRGLVEKPPAEKAPSNLAVA
GRYILERAIFDALREVAPGAGGEIQLTDAIALLIDRGRPVHLVVWDGYRHDLGNPGGYLK
ASIDFALDREEYGPGLRAWLISRLGLS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacgagaattccctctccacccttcctcgccctggcatgccccacaccgcg
gtggtccccgccgccggcatgggcacccgcttcctccccgtgaccaagtcagtcccgaaa
gaactcctgcccgtggtggacaccccggggatcgaactcgtggccgccgaggccgcccag
gccggggcgcagcgcctggtcatcgtcacctccgagggcaaagactccgttgtcgcccac
ttcgtcgaagaccttgtgctcgaaagcgcgctggaggccaaaggcaaatcggccatgttg
gagaaagtgcgccgcgcccccaagctcatcaaggtcgagtcagtcatccaacatcaaccg
ctcgggctcggccacgccatcgcccaagtcgaacccttgctgcatccggacgacgacgcg
atcgcggtcctgctgcccgacgacctcgtgctcaaatccccgcaacaagtggcgcaggag
cgcgagcgggacatctgcgaccagatcgaaatccgcgagaaggtgggcgcgctcaatctc
atggcgcaagtgcgtgccgaacacggcggcagcgtcatctgcgcgttcccggtcccgcgt
gaggagatcagcgcgtacggcgtcttcgacgtcgtcgaacaggaaggcccggtgcgccgt
gtgcgcggcctggtcgagaaaccgcccgccgagaaggccccgtcgaatctggccgtcgcg
ggacggtacatcttggaacgggccatcttcgacgccctgcgcgaagtcgccccaggggcg
ggcggagagatccagctcaccgatgcgattgccctgctcatcgaccgaggccgccctgtg
catctcgtggtctgggacggctaccgccacgacctcggcaaccccggcggctacctgaaa
gcctcgatcgatttcgcattggaccgagaagagtacggccccggcctgcgcgcttggttg
atcagccggctcgggctgagttaa

DBGET integrated database retrieval system