KEGG   Segniliparus rotundus: Srot_0508Help
Entry
Srot_0508         CDS       T01238                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
srt  Segniliparus rotundus
Pathway
srt00040  Pentose and glucuronate interconversions
srt00052  Galactose metabolism
srt00500  Starch and sucrose metabolism
srt00520  Amino sugar and nucleotide sugar metabolism
srt01100  Metabolic pathways
srt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Srot_0508
   00052 Galactose metabolism
    Srot_0508
   00500 Starch and sucrose metabolism
    Srot_0508
   00520 Amino sugar and nucleotide sugar metabolism
    Srot_0508
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Srot_0508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75
Motif
Other DBs
NCBI-ProteinID: ADG96992
UniProt: D6ZC15
Position
complement(486798..487781)
Genome map
AA seq 327 aa AA seqDB search
MAENENSLSTLPRPGMPHTAVVPAAGMGTRFLPVTKSVPKELLPVVDTPGIELVAAEAAQ
AGAQRLVIVTSEGKDSVVAHFVEDLVLESALEAKGKSAMLEKVRRAPKLIKVESVIQHQP
LGLGHAIAQVEPLLHPDDDAIAVLLPDDLVLKSPQQVAQERERDICDQIEIREKVGALNL
MAQVRAEHGGSVICAFPVPREEISAYGVFDVVEQEGPVRRVRGLVEKPPAEKAPSNLAVA
GRYILERAIFDALREVAPGAGGEIQLTDAIALLIDRGRPVHLVVWDGYRHDLGNPGGYLK
ASIDFALDREEYGPGLRAWLISRLGLS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacgagaattccctctccacccttcctcgccctggcatgccccacaccgcg
gtggtccccgccgccggcatgggcacccgcttcctccccgtgaccaagtcagtcccgaaa
gaactcctgcccgtggtggacaccccggggatcgaactcgtggccgccgaggccgcccag
gccggggcgcagcgcctggtcatcgtcacctccgagggcaaagactccgttgtcgcccac
ttcgtcgaagaccttgtgctcgaaagcgcgctggaggccaaaggcaaatcggccatgttg
gagaaagtgcgccgcgcccccaagctcatcaaggtcgagtcagtcatccaacatcaaccg
ctcgggctcggccacgccatcgcccaagtcgaacccttgctgcatccggacgacgacgcg
atcgcggtcctgctgcccgacgacctcgtgctcaaatccccgcaacaagtggcgcaggag
cgcgagcgggacatctgcgaccagatcgaaatccgcgagaaggtgggcgcgctcaatctc
atggcgcaagtgcgtgccgaacacggcggcagcgtcatctgcgcgttcccggtcccgcgt
gaggagatcagcgcgtacggcgtcttcgacgtcgtcgaacaggaaggcccggtgcgccgt
gtgcgcggcctggtcgagaaaccgcccgccgagaaggccccgtcgaatctggccgtcgcg
ggacggtacatcttggaacgggccatcttcgacgccctgcgcgaagtcgccccaggggcg
ggcggagagatccagctcaccgatgcgattgccctgctcatcgaccgaggccgccctgtg
catctcgtggtctgggacggctaccgccacgacctcggcaaccccggcggctacctgaaa
gcctcgatcgatttcgcattggaccgagaagagtacggccccggcctgcgcgcttggttg
atcagccggctcgggctgagttaa

DBGET integrated database retrieval system