KEGG   Segniliparus rotundus: Srot_0558Help
Entry
Srot_0558         CDS       T01238                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
srt  Segniliparus rotundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Srot_0558
Enzymes [BR:srt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Srot_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536809..538017
Genome map
AA seq 402 aa AA seqDB search
MGMDTTSPESDRVLPERVPPERTLSGYTVGVTAARRADEFAALLTRRGAVVLHAPAIVII
PLADDAELERVSREIIQNPPDVAVATTGIGFRGWLEAAEGWGVAEELRNALQGSRLVARG
PKATGAIRAAGLREAWSPSSESSSEVLERLLEEGVQGLRVAVQLHGATTEFEPLPDFSEA
LQAAGAQVLAVPVYRWEPPHDQSAMDALIAAVAQGTVDGVSFTSAPAVASMLGRAKETGM
FEQLLDGFRAQVAALCVGPVTAAPLEALGVPTSAPARSRLGALARHIEEELPRRAKVFRA
HGHTIAVLARAVVVDGEVRHLAPSMLTLLRALARQPGRVVTREALLASLPGHSADAHAVE
AAIGRLRTGLGDPKIVQTVVKRGYRLAADWGVDDFGASADKY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggacaccaccagcccggagtccgatagagttctgccagagcgcgtcccgccg
gaaaggaccctgtcggggtacaccgtcggggtgacggccgcgcgccgcgccgacgagttc
gccgcgcttttgacccgtcgcggcgccgtcgtgctgcacgccccggcgattgtgattatc
ccgttggccgacgacgccgaattggagcgagtcagcagggagatcatccagaatccgccg
gatgtggccgtcgcgacgaccggcatcggtttccggggctggctggaagcagccgaaggc
tggggcgtcgccgaggagctgcgcaacgcgctgcagggctcgcggctggtggcgcgcggc
ccgaaagccaccggcgcgatccgtgcggctggcttgcgcgaggcgtggtcgccaagctcg
gagtcgtcgagcgaagtcttagaacgcctgctggaagaaggcgtgcaagggttgcgtgtg
gcggtccagctgcacggggcgaccacagagttcgagccgctgcccgacttcagcgaagca
ttgcaggccgcgggcgcgcaggtgctggccgtgccggtctaccgttgggagccgccgcac
gaccagtccgcgatggatgcgctgatcgcggctgtggcgcaggggacggtcgacggcgtg
agcttcaccagcgcccctgctgtcgcgtccatgctgggcagagccaaagagacgggcatg
ttcgagcagctcctcgatggtttccgcgcccaggtggcggcgctttgcgtcggcccggtg
accgccgcgccgcttgaggcgctcggcgtgccgacgagcgccccggcccgttcccggctc
ggggcgctggcccggcatatcgaggaggagctgccgagacgggcgaaggtgttccgggcc
cacggccacaccatcgccgtcctcgcccgggccgttgtggtggacggcgaggtccgccac
ctcgcgccgtccatgctgacgctgctgcgagcattggcccgccagcccggacgagtggtc
actcgcgaggcattgctcgcgagcctgcccggacacagcgccgacgcgcacgcggtggag
gccgcgatcggcaggctccgaactggtttgggagatccgaagatcgtgcagaccgtggtc
aagcgcggataccggctcgccgctgactggggggtcgacgacttcggagccagcgccgac
aaatactga

DBGET integrated database retrieval system