KEGG   Segniliparus rotundus: Srot_0618Help
Entry
Srot_0618         CDS       T01238                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
srt  Segniliparus rotundus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Srot_0618
   01230 Biosynthesis of amino acids
    Srot_0618
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Srot_0618
   00051 Fructose and mannose metabolism
    Srot_0618
   00562 Inositol phosphate metabolism
    Srot_0618
Enzymes [BR:srt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Srot_0618
Exosome [BR:srt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Srot_0618
  Exosomal proteins of bladder cancer cells
   Srot_0618
  Exosomal proteins of melanoma cells
   Srot_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599593..600387
Genome map
AA seq 264 aa AA seqDB search
MTSPSRQPLIAGNWKMNLNHFEAIALVQKLCHALKAEHFETVQTSVLVPFTDIRSVQAVV
ESDGLPVEYGAQDLSKHDAGAYTGEVSGAFLAKLGCTQVVVGHSERRAYHHETDELVAAK
AKAALKHGLTPIVCVGEGEDVREAGRHIAHCDSQLRASLAGLSEDELAKVVIAYEPVWAI
GTGRVASPKDAQEVCGAMRKALAEIGGDHVARAARVLYGGSVNKGNAAELLAEPDVDGAL
VGGASLKVEEFAAIVAFAALAAKS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacttccccgtcacgccagcccctgatcgcgggcaactggaagatgaacctgaatcat
ttcgaggccatcgccctggtgcagaaactgtgccatgccctcaaggccgagcatttcgag
acggtgcagacatcggtgctcgtcccgttcacggacatcaggagcgtccaagcagtggtg
gaatcggacggcctgccggtcgaatacggcgctcaggacctttcgaagcacgacgcgggg
gcctacaccggcgaagtctccggggcgttcctcgccaaactcggttgcacgcaggtcgtc
gtcgggcactccgagcgccgggcctaccaccacgagacggacgagttggtcgccgcgaag
gccaaagcggcgctcaaacatggcctgacccccattgtctgtgtcggcgaaggcgaggac
gtccgggaagcgggcaggcacattgcgcattgcgacagccaattgcgcgcctcgctcgcc
gggttgtccgaggacgagctcgccaaggttgtgatcgcctacgagcctgtttgggccatc
ggcaccggccgggtcgcgagtccgaaggacgcccaggaggtgtgcggcgcgatgcgcaag
gcgctcgcggagatcggcggcgaccacgtcgcccgcgcggcgcgtgtgctgtacggcggt
tcggtgaacaaaggcaacgccgctgagctgctggcagagcctgacgtggacggggccttg
gtcggcggcgcttcgctcaaggtcgaagagttcgcggcgatcgtcgctttcgccgcattg
gccgcgaaatcctag

DBGET integrated database retrieval system