KEGG   Segniliparus rotundus: Srot_0683Help
Entry
Srot_0683         CDS       T01238                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
srt  Segniliparus rotundus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Srot_0683
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Srot_0683
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Srot_0683
Enzymes [BR:srt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Srot_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668424..669500
Genome map
AA seq 358 aa AA seqDB search
MTDKAWRGLIHAYRQWLDLGAAQGSAAEPVTLFEGNTPLVPAPRIGELIGCELWLKVEGA
NPTGSFKDRGMTAAVTDAVARGQKVLLCASTGNTSASAAAYAARAGLACAVLIPEGKIAA
GKLAQAVVYGAKIIQVRGNFDDCLELARKTASSFPHVALVNSVNPVRIEGQKTAAFEIMD
VLGRAPDIHALPVGNAGNITAYWRGYKQWHEAGVVSAAPKMLGVQAAGAAPLVHGAPVKD
PETIATAIRIGAPASWDGALAAKEQSGGQFRAVTDEALLSAYQLLASKEGVFVEPASATS
VAGLLAARADGWAPEGSLVVATVTGNGLKDPATALNSMPELKAIDVDPALVLSELGLD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaggcgtggcgcgggctgatccacgcgtaccggcaatggctggaccttggc
gccgcgcaaggctccgccgccgagccggtgacgctcttcgagggcaacaccccgctggtc
ccggcccctcggatcggcgagctcatcggatgcgagctctggctgaaagtggagggcgcg
aaccccaccgggtccttcaaggaccggggcatgaccgccgcggtgaccgacgcggtggcg
cgcggccagaaggtgcttttgtgcgcctccaccggcaacacgtccgcctcggccgcggcg
tacgccgcacgggccggtctcgcctgcgccgtcctcatccctgagggcaagatcgcggcg
ggcaagctcgcccaggcggtggtgtacggcgcgaagatcatccaggtgcgcggcaacttc
gacgactgcctggagctcgcgcgcaaaacagcctcttcgttcccgcatgtggcattggtg
aactccgtgaacccggtgcgcatcgagggccagaaaacggctgctttcgagatcatggac
gtgcttggccgggccccggacatccacgcgttgccggtcggcaacgccgggaacatcacc
gcgtactggcgcggctacaagcagtggcatgaggccggggtggtgtcggcggcgccgaag
atgctcggcgtccaagcggcgggggccgcgccgctcgtccacggagccccggtcaaagac
ccggagaccattgcgacggcgattcggatcggcgcccctgcctcatgggacggcgcgctc
gccgcgaaagagcagtcgggcggccaattccgggccgtgaccgacgaggcgttgttgtcc
gcgtaccagctcttggccagcaaggagggcgttttcgtcgagcccgcctccgcgacgtcc
gtcgcggggctgctcgccgcgcgcgcggacggctgggccccggaaggcagcctcgtggtc
gccacggtgaccggcaacggcctcaaggacccggccaccgcgctcaacagcatgccggaa
ctcaaagctatcgacgtggaccccgcgttggtgctcagcgagctcggccttgactga

DBGET integrated database retrieval system