KEGG   Segniliparus rotundus: Srot_0864Help
Entry
Srot_0864         CDS       T01238                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
srt  Segniliparus rotundus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:srt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
852392..853243
Genome map
AA seq 283 aa AA seqDB search
MPELPEVEVVRRGLAEHLTGARIRALRVLHPRSARRHPGGGAFLAAALSERDVRAVRRRG
KYLWLVLDDEESVVIHLGMSGQFRVGDQGVPGNPAHLRVEADLADGRTLQFFDQRTFGGW
EFAALQEVDGELVPAPVAHIARDPFDPKFDPAAVARRVRAKRSAIKRVLLDQTVLSGVGN
IYADESLWRARLHGEQPAAGLSPRKTAELLDALAVVLGESITEGGTSFDSLYVNVNGESG
RFSDWLAVYGQEGKPCRRCGSAIRREAFMNRSSHYCPRCQRLP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaactccccgaggtcgaggttgttcgtcgagggctcgcggagcatctcacgggc
gcgcgaatccgcgcgctgcgcgtgctgcacccccgttctgcgcgccgccatcctggcggg
ggagcgttcttggccgccgcgttgtcggaacgcgacgtccgggcagtgcgccgccgcggc
aaatacttgtggctggtcttggacgacgaagagtccgtggtgatccacctcggcatgagc
gggcagttccgggtgggcgaccagggagtcccagggaaccccgcgcacctgcgcgtcgaa
gcagatctcgcggacggccggacgctgcaattcttcgaccagcggaccttcgggggatgg
gagttcgccgcgctgcaagaggtcgatggcgaactggtccccgcgccggtcgcgcatatc
gcccgcgaccctttcgacccgaagttcgatcccgccgccgtcgcgcggcgcgtccgcgcc
aaacggtcggcgatcaagcgggtcttgctggaccagaccgtgctttccggcgtcggcaac
atctacgcggacgagtcgctgtggcgggctcggctgcacggcgaacagccggccgcgggg
ctgagcccacgcaaaaccgcggagttgttggacgctctcgccgttgtgctgggcgagtcg
atcaccgagggcggcacgagctttgactccctgtatgtgaacgtgaacggcgaatcaggc
cggttctcggactggctggcggtgtacgggcaggaaggcaagccgtgccgccgttgcgga
tcggcgattcggcgcgaggcgttcatgaaccggtcctcgcattactgcccccggtgtcag
cgcctgccgtga

DBGET integrated database retrieval system