KEGG   Segniliparus rotundus: Srot_1118Help
Entry
Srot_1118         CDS       T01238                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
srt  Segniliparus rotundus
Pathway
srt00010  Glycolysis / Gluconeogenesis
srt00620  Pyruvate metabolism
srt00640  Propanoate metabolism
srt00680  Methane metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Srot_1118
   00620 Pyruvate metabolism
    Srot_1118
   00640 Propanoate metabolism
    Srot_1118
  Energy metabolism
   00680 Methane metabolism
    Srot_1118
Enzymes [BR:srt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Srot_1118
Lipid biosynthesis proteins [BR:srt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Srot_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADG97591
UniProt: D6ZF67
Position
complement(1093432..1095375)
Genome map
AA seq 647 aa AA seqDB search
MTQQDLDVYAPGPEFALAANAGAELYEQAGKDRLAFWAEQAARLDWSTPFEQVLDWSEAP
VAKWFVGGKLNVAANCLDRHVRAGLGDKVALHWIGETAERRDITYAQLTELTNQTANLFA
SLGIGAGDRVAIYLPMIPEAIAAMLACARLGATHTVVFAGFSAHALKTRIADSRAALVVT
SDGQYRRGAPVELKTAVDQALADLDADGANPVEHVLVVRRTGIEVEWTKRDVWWDEAVPQ
QPTTHTPEAFDSEHPLFLLYTSGTTGNPKGILHTSGGYLVQTSYTHHHVFDHKPETDVYW
CTADIGWVTGHSYIVYGPLSNAATQVLYEGTPNHPDEHRHFEVIETLGVSIYYTAPTLIR
TFMKWGRQIPDAHDLSSLRLLGSVGEPINPEAWRWYREVIGGGRTPIVDTWWQTETGAIM
ISPLPGVTATKPGSAMAALPGISAKVVDERGEPVAPGSNGYLVLDQPWPAMLRGIWGDAD
RFAKTYWSQYERQRWYFAGDGARLDEDGALWVLGRVDDVMNVSGHRISTAEVESALVGHR
DIAEAAVIGASDETTGQAVVAFVILAQHAPAPEKELVAELKRQVSTEISPIAKPRDIYVV
PELPKTRSGKIMRRLLRDLAEHRALGDVSTLVDPGVFDAIKHAVENS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagcaagatctcgacgtgtacgcccccggcccggagttcgccttggccgcgaac
gccggcgctgagctgtacgaacaggcaggcaaagatcggctcgcgttctgggccgaacaa
gccgcccggctcgattggtcgacgccgttcgagcaggtgctcgactggtctgaagccccc
gtcgcgaagtggttcgtcggcgggaagctcaatgtcgcggcgaactgcctggaccggcat
gttcgcgccgggctcggcgacaaagtcgcgctgcactggatcggcgagaccgcagaacgc
cgcgacatcacctacgcccagctcaccgaactgaccaatcagacagcgaacctcttcgct
tccctggggatcggcgcaggggaccgagtcgcgatctaccttcccatgattcccgaggcc
atcgcggcgatgctcgcctgcgcgcgcctcggcgcgacgcacacggttgttttcgccggg
ttctccgcgcacgccctgaagacccggatcgccgactctcgggccgccttggtcgtcacc
tcggacgggcagtaccgccgaggcgcccctgtcgagctcaagaccgctgtggaccaggcg
ctggccgatctggacgcggacggcgcgaacccggtcgaacatgtgctcgtcgtgcgccgc
accgggatcgaggtggagtggaccaagcgggacgtctggtgggacgaggccgtgccgcag
cagcccaccacgcacaccccggaggcgttcgactccgagcatcccctcttcttgctctac
acctccggcaccacgggcaacccgaaaggcattctgcacaccagcgggggctacctcgtg
cagacctcgtacacgcaccaccacgtcttcgaccacaaacccgagacggacgtctactgg
tgcaccgccgacatcggctgggtgaccgggcacagctacatcgtctacggcccgttgtcg
aacgcggcgacccaggtgctctacgaaggcaccccgaaccaccccgacgagcaccggcat
ttcgaggtgatcgaaacactcggggtgagcatctattacaccgcgccgaccctcatccgc
accttcatgaaatggggcaggcaaatcccggacgcgcacgacctgagctcgctgcgcctg
ctcggcagcgtcggggagccgatcaacccggaagcctggcgttggtaccgcgaggtgatc
ggcggcgggaggacgccgatcgtggacacctggtggcagaccgagaccggcgccatcatg
atctctcccctgccgggggtcaccgcgacaaagcccggctccgcgatggcggccctgcca
gggatcagcgcgaaagtcgtcgatgagcgcggcgagcctgtcgccccaggctccaacggc
tacctggtgctcgaccagccttggccggctatgctgcgcgggatttggggcgatgcggac
aggttcgcaaagacctactggtcgcagtacgagcggcagcgctggtatttcgccggggac
ggagccaggttggacgaggacggagccctttgggtgctcggccgggtggacgacgtcatg
aatgtctcgggccaccggatctccactgccgaggtggagtccgcgctcgtcgggcaccgt
gacatcgccgaggccgcggtgatcggcgcgtccgacgagaccaccgggcaggccgtggtc
gccttcgtgatcctcgcccagcacgcgccggcgccggaaaaagagctggtcgccgagctc
aagcggcaagtctccacggaaatctcccccatcgccaagccgagggacatctacgtcgtc
ccggagctgcccaagacccgcagcggcaaaatcatgcgacggctcctgcgcgacctggcc
gagcaccgcgccctcggcgacgtctcgacattggtggaccctggcgtcttcgacgcgatc
aaacacgccgttgaaaacagctga

DBGET integrated database retrieval system