KEGG   Segniliparus rotundus: Srot_1137Help
Entry
Srot_1137         CDS       T01238                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
srt  Segniliparus rotundus
Pathway
srt00010  Glycolysis / Gluconeogenesis
srt00030  Pentose phosphate pathway
srt00051  Fructose and mannose metabolism
srt00052  Galactose metabolism
srt00680  Methane metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Srot_1137
   00030 Pentose phosphate pathway
    Srot_1137
   00051 Fructose and mannose metabolism
    Srot_1137
   00052 Galactose metabolism
    Srot_1137
  Energy metabolism
   00680 Methane metabolism
    Srot_1137
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Srot_1137
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Srot_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DUF3416 AIRC
Motif
Other DBs
NCBI-ProteinID: ADG97610
UniProt: D6ZF86
Position
1119205..1120239
Genome map
AA seq 344 aa AA seqDB search
MKRIGVLTGGGDCPGLNAVIRAVVRTSVGRYRSTVVGFRDGWRGLLEDRRTKLDDLDKID
RILTRGGTILGTARVNPDKLRAGLDRIKQTLDDNGVDVLIPIGGEGTLTAASWLSESGVP
VVGVPKTIDNDIDCTDVTFGFDTALAIATDAIDRLHTTAESHQRVMLVEVMGRHAGWIAL
HAGLASGAHLTLIPEVPFDVDEVCAMIKKRFQRGDAHFIVVVAEGAAPDPRSMTLAEGGV
DEFGHKIFTGVSQQLGREIEKRIGKEVRVTVLGHVQRGGTPTPFDRVLATRYGVHAAEAA
HNGGEGNMVALHGTKIELVPLSEATKQLKRVPSERYEEARAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggatcggcgttttgactggcggcggagactgcccgggcttgaatgcggttatc
cgcgctgtggtgcgcacttctgtcggccgctaccgcagcaccgtcgtcggtttccgcgac
ggatggcggggccttttggaggaccggcgcaccaagctcgacgacctcgacaaaattgac
cggattttgacgcgcggcggcaccatcctcggcaccgcgcgggtgaacccggacaagttg
cgcgcgggtctggaccggatcaagcagaccctcgacgacaacggggtcgacgtgctcatc
cccatcggcggcgagggcacgttgacggcggcgagctggttgtcggaatccggcgtcccc
gtggtcggcgtgccgaagaccattgacaacgacatcgactgcacggatgtcacgttcggc
ttcgacaccgcgttggccattgcgacagatgcgatcgaccggctgcacaccactgccgag
tcccatcagcgggtgatgctcgtggaggtcatgggccgccacgcggggtggatcgcgctg
cacgccggactggcctcgggcgcgcatctcaccctcatccccgaggtgccgttcgacgtg
gacgaggtctgcgccatgattaagaagcgtttccagcgcggcgacgcgcatttcatcgtg
gtggtggcggaaggagccgctccggaccctcggtcgatgacgctggccgagggcggcgtc
gacgagttcgggcacaagattttcaccggtgtgtcgcagcagctcggccgggagatcgag
aaacggatcggcaaagaggttcgcgtgactgttctcgggcatgtgcagcgcggtggaacg
ccgacgccgttcgaccgggtgctcgcgactcggtacggcgtgcacgccgccgaagcggcg
cacaatggcggcgaaggcaacatggtggctctgcacggcacgaagatcgagctggtcccg
ttgtccgaggccaccaaacagctcaaacgggttccgtcggagcgttacgaagaagccagg
gctttcttcggctag

DBGET integrated database retrieval system