KEGG   Segniliparus rotundus: Srot_1137Help
Entry
Srot_1137         CDS       T01238                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srt  Segniliparus rotundus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:srt01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:srt01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:srt00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:srt00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:srt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:srt00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:srt00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119205..1120239
Genome map
AA seq 344 aa AA seqDB search
MKRIGVLTGGGDCPGLNAVIRAVVRTSVGRYRSTVVGFRDGWRGLLEDRRTKLDDLDKID
RILTRGGTILGTARVNPDKLRAGLDRIKQTLDDNGVDVLIPIGGEGTLTAASWLSESGVP
VVGVPKTIDNDIDCTDVTFGFDTALAIATDAIDRLHTTAESHQRVMLVEVMGRHAGWIAL
HAGLASGAHLTLIPEVPFDVDEVCAMIKKRFQRGDAHFIVVVAEGAAPDPRSMTLAEGGV
DEFGHKIFTGVSQQLGREIEKRIGKEVRVTVLGHVQRGGTPTPFDRVLATRYGVHAAEAA
HNGGEGNMVALHGTKIELVPLSEATKQLKRVPSERYEEARAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggatcggcgttttgactggcggcggagactgcccgggcttgaatgcggttatc
cgcgctgtggtgcgcacttctgtcggccgctaccgcagcaccgtcgtcggtttccgcgac
ggatggcggggccttttggaggaccggcgcaccaagctcgacgacctcgacaaaattgac
cggattttgacgcgcggcggcaccatcctcggcaccgcgcgggtgaacccggacaagttg
cgcgcgggtctggaccggatcaagcagaccctcgacgacaacggggtcgacgtgctcatc
cccatcggcggcgagggcacgttgacggcggcgagctggttgtcggaatccggcgtcccc
gtggtcggcgtgccgaagaccattgacaacgacatcgactgcacggatgtcacgttcggc
ttcgacaccgcgttggccattgcgacagatgcgatcgaccggctgcacaccactgccgag
tcccatcagcgggtgatgctcgtggaggtcatgggccgccacgcggggtggatcgcgctg
cacgccggactggcctcgggcgcgcatctcaccctcatccccgaggtgccgttcgacgtg
gacgaggtctgcgccatgattaagaagcgtttccagcgcggcgacgcgcatttcatcgtg
gtggtggcggaaggagccgctccggaccctcggtcgatgacgctggccgagggcggcgtc
gacgagttcgggcacaagattttcaccggtgtgtcgcagcagctcggccgggagatcgag
aaacggatcggcaaagaggttcgcgtgactgttctcgggcatgtgcagcgcggtggaacg
ccgacgccgttcgaccgggtgctcgcgactcggtacggcgtgcacgccgccgaagcggcg
cacaatggcggcgaaggcaacatggtggctctgcacggcacgaagatcgagctggtcccg
ttgtccgaggccaccaaacagctcaaacgggttccgtcggagcgttacgaagaagccagg
gctttcttcggctag

DBGET integrated database retrieval system