KEGG   Segniliparus rotundus: Srot_1137Help
Entry
Srot_1137         CDS       T01238                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
srt  Segniliparus rotundus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Srot_1137
   01230 Biosynthesis of amino acids
    Srot_1137
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Srot_1137
   00030 Pentose phosphate pathway
    Srot_1137
   00051 Fructose and mannose metabolism
    Srot_1137
   00052 Galactose metabolism
    Srot_1137
  Energy metabolism
   00680 Methane metabolism
    Srot_1137
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Srot_1137
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Srot_1137
Protein phosphatases and associated proteins [BR:srt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Srot_1137
Messenger RNA biogenesis [BR:srt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Srot_1137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119205..1120239
Genome map
AA seq 344 aa AA seqDB search
MKRIGVLTGGGDCPGLNAVIRAVVRTSVGRYRSTVVGFRDGWRGLLEDRRTKLDDLDKID
RILTRGGTILGTARVNPDKLRAGLDRIKQTLDDNGVDVLIPIGGEGTLTAASWLSESGVP
VVGVPKTIDNDIDCTDVTFGFDTALAIATDAIDRLHTTAESHQRVMLVEVMGRHAGWIAL
HAGLASGAHLTLIPEVPFDVDEVCAMIKKRFQRGDAHFIVVVAEGAAPDPRSMTLAEGGV
DEFGHKIFTGVSQQLGREIEKRIGKEVRVTVLGHVQRGGTPTPFDRVLATRYGVHAAEAA
HNGGEGNMVALHGTKIELVPLSEATKQLKRVPSERYEEARAFFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacggatcggcgttttgactggcggcggagactgcccgggcttgaatgcggttatc
cgcgctgtggtgcgcacttctgtcggccgctaccgcagcaccgtcgtcggtttccgcgac
ggatggcggggccttttggaggaccggcgcaccaagctcgacgacctcgacaaaattgac
cggattttgacgcgcggcggcaccatcctcggcaccgcgcgggtgaacccggacaagttg
cgcgcgggtctggaccggatcaagcagaccctcgacgacaacggggtcgacgtgctcatc
cccatcggcggcgagggcacgttgacggcggcgagctggttgtcggaatccggcgtcccc
gtggtcggcgtgccgaagaccattgacaacgacatcgactgcacggatgtcacgttcggc
ttcgacaccgcgttggccattgcgacagatgcgatcgaccggctgcacaccactgccgag
tcccatcagcgggtgatgctcgtggaggtcatgggccgccacgcggggtggatcgcgctg
cacgccggactggcctcgggcgcgcatctcaccctcatccccgaggtgccgttcgacgtg
gacgaggtctgcgccatgattaagaagcgtttccagcgcggcgacgcgcatttcatcgtg
gtggtggcggaaggagccgctccggaccctcggtcgatgacgctggccgagggcggcgtc
gacgagttcgggcacaagattttcaccggtgtgtcgcagcagctcggccgggagatcgag
aaacggatcggcaaagaggttcgcgtgactgttctcgggcatgtgcagcgcggtggaacg
ccgacgccgttcgaccgggtgctcgcgactcggtacggcgtgcacgccgccgaagcggcg
cacaatggcggcgaaggcaacatggtggctctgcacggcacgaagatcgagctggtcccg
ttgtccgaggccaccaaacagctcaaacgggttccgtcggagcgttacgaagaagccagg
gctttcttcggctag

DBGET integrated database retrieval system