KEGG   Segniliparus rotundus: Srot_1194Help
Entry
Srot_1194         CDS       T01238                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
srt  Segniliparus rotundus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Srot_1194
DNA repair and recombination proteins [BR:srt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Srot_1194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1164627..1165265)
Genome map
AA seq 212 aa AA seqDB search
MFEGPVQDLIDELSRLPGVGPKGAQRIAFHLVGSPKPEIDRLVSALAKIRDGVRFCDICG
NIAADVTCRVCADARRDLTRICVVSQPKDVAAIERTREFHGRYHVLGGALNPLAGIGPDR
LRVKELLTRLGASADGVTVTEIIIATDPNTEGEATATYLARMLANFPDLEVTRLASGLPM
GGDLEFADEMTLGRALAGRRALTEGHTAHTRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaaggcccggtccaggaccttatcgatgaattgagccgcctgcccggagtcggg
cccaagggcgctcaacgcattgcgttccacctcgtggggtccccgaagccggagatcgac
cggctcgtctctgcgctcgccaaaatccgcgacggcgtgcgcttctgcgacatctgcggg
aacatcgcagcggatgtgacctgccgggtttgcgcggacgcgcgcagagacctgacccgg
atctgcgtcgtctcccagcccaaggatgtggccgccatcgagcgcacccgagaattccat
ggccgctaccatgtgctcggcggagcgctgaaccctctcgcggggatcggccccgaccgg
ctgcgcgtcaaagagctgctgacacgtctcggcgcctccgcggacggcgtgaccgtcacc
gagatcatcatcgccaccgacccgaacacggaaggcgaggcgaccgcgacctatctcgcc
cgaatgctcgccaacttcccagacttggaagtcaccaggctcgcctccggcttgccgatg
ggcggagatttagaattcgcggacgagatgacactgggccgggcgctcgccgggcgccgc
gcgctcaccgaggggcacacagcgcacacgcggaaatga

DBGET integrated database retrieval system