KEGG   Segniliparus rotundus: Srot_1400Help
Entry
Srot_1400         CDS       T01238                                 

Definition
group 1 glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
srt  Segniliparus rotundus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Srot_1400
Enzymes [BR:srt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Srot_1400
Glycosyltransferases [BR:srt01003]
 Polysaccharide
  Storage polysaccharide
   Srot_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1397324..1398577)
Genome map
AA seq 417 aa AA seqDB search
MRVLLLSWEHPPVVVGGLGKHVQELAKALAALGHEVAVLSRGPMGATASQCPRPETTQDG
VRVVLVPEDPLSLEFGSDLVAWTLSLGHAMLRAGLSLAETFQPDVLHAHDWLVAAPAIAL
AEHLDIPLITTVHATEAGRHDGWIGNAVSAQVHSAEHWLVRSSDALICCSESMRRETSAL
FGITGAAEEPSVIPNGIDLSAWPFTPPDRCAAVPKLLFVGRLEYEKGVHDLIESLPLIRE
AHPGTTLSVVGAGTQERWLREVARDHKVASAVRFFGNLDHVGIRRHMRSSSVMVVPSRYE
PFGLVALEGAAAGIPLVVADTGGLGEAVAENRTGWSFPPGDVPALAEAVSRSLASPTRSA
RRAKAARERISSEFDWLRVAERTAEVYRNAKRQSDRQPIPRPSLHLPVRLLPRGPQP
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcttgctcagctgggagcatcctcccgtcgtggtcggcgggctcggcaag
catgtgcaggagctggccaaggccctggccgctctcggacacgaggttgcagtgctgtcc
cgaggcccgatgggggccacagcctcgcagtgcccgcgccccgagacaacacaggacggc
gtgcgggtcgtgttggtgcccgaagacccgttgagcctcgaattcggctccgatctggtc
gcgtggacgctctcgctgggccacgcgatgctccgggccggcctctcgctcgcagaaacg
ttccaacccgatgtgctgcacgcccatgactggctggtggcggcccccgcgatcgcgttg
gccgaacacctcgacatcccgctcatcaccacagtccacgccactgaagcgggccgtcac
gacggctggatcggcaatgcggtcagcgctcaagtgcattcggcagagcactggctggtg
cgctcctcagacgcgctgatttgctgctcggagtccatgcgccgcgaaacgagcgcgctc
ttcgggatcacgggggccgccgaggagccgtcggtgatccccaatggcatcgatctgtcc
gcatggccgttcacacccccggaccgctgtgccgcggtgcccaaattgctcttcgtggga
cggctcgaatacgagaaaggcgtgcacgacctcatcgaatcgctgcctctgatccgcgaa
gcgcacccagggacgacgctgtctgtggtcggcgcaggcacccaggagcgctggctccgc
gaggtggctcgggatcacaaggtggccagcgcggtcaggtttttcgggaacctcgaccac
gtcggaatccgccgccatatgcggtcgtcctctgtgatggtcgtgccgagccgttacgag
cctttcggcttagtcgcgctggaaggcgcggccgcaggaatacctctggtcgtggccgac
accggcgggctgggcgaggcggtggctgaaaaccgcaccggctggtctttcccgcccggc
gacgtccccgcgctcgccgaagcggtgagccgctcgctcgcgagcccgacgcgctcggcg
cgcagagcaaaagcagcgcgggagcggatcagcagtgaattcgactggctccgcgtcgcg
gaacggaccgccgaggtgtaccgaaacgcgaaacggcaaagcgaccggcagcccatccca
cggccctcgctgcaccttccggtgcggcttttgccgcgaggaccacagccgtga

DBGET integrated database retrieval system