KEGG   Segniliparus rotundus: Srot_1401Help
Entry
Srot_1401         CDS       T01238                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
srt  Segniliparus rotundus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:srt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1398577..1400145)
Genome map
AA seq 522 aa AA seqDB search
MTRGGAAGQTVPGMFSLVLHTHLPWVVHHGRWPVGEEWLYQAWAQSYLPLFSLLRRLGER
GRANLLSLSLTPVLAAQLDDPSALAGMRHWLANWALRADEAAVVQSTGARPGTASSPEAL
RRLGAHERREAGAALAEFESNWLHGGSPVVRDLVDSGVIELLGGPLAHSFSPLLHPRLRE
FALREGLADAQARGLGRPGGIWAPECAFTPGMGAEYAQAGVRRFLLDGPAMHGETTLARP
VEGTDVLAFGRDLAVTYRVWSPKSGYPGDGAYRDFHTYDHLVGLKPARVTGHHVPGEEKA
PYDPARAQIAVRRDVDDFVQTVRERLSAESARTGRPALVVAAFDTELFGHWWHEGPQWLE
QVLTALPAAGVRVGTLAEAAANGFVGERLDPADCSWGSGKDWRVWSGPQVADLVELNADV
AETALRTVDKRLAGTQLFRDRVSDQILRETLLTVASDWAFLVSKDTAAQYARDRAHLHAH
AVREIAQAAESGHEGKAVRLAQGWNIADSLFGQLDARRLGPR
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
gtgactcggggcggcgcggcgggtcagaccgtgcccggcatgttctccctcgttctgcac
acccacctgccctgggtggtccaccacggccggtggccggtgggcgaagagtggctgtat
caagcttgggcgcagtcgtatctgccgctgttctccctgctgcgcaggctgggcgagcgc
ggacgcgcgaacctgctctctttgtcgctcaccccggtgttggcggcgcagctggacgac
cccagcgccctggccggcatgcggcattggctcgcgaactgggccctgcgcgccgacgag
gccgccgttgtccaatccaccggggctcgtccgggcaccgcaagctcgccagaggcgctg
cgccgcctcggcgcgcacgagcgccgagaggctggcgcggcgctcgccgagttcgagtcc
aactggctgcacggcgggtccccggtggtgcgagatctggtggattccggtgtgatcgag
ctgctcggcgggccgctcgcccactccttcagcccgttgctgcacccgaggctgcgcgag
ttcgccctgcgagagggcctcgccgacgcgcaggcccgcgggctcgggcgccccgggggg
atttgggcgcccgaatgcgcgttcacgccagggatgggcgcagaatacgcacaagccggc
gtgcggcggttcctgctcgacgggcccgcgatgcacggcgagaccacgctcgcgcgaccg
gtggagggcacagatgtgctcgcgttcgggcgcgacctcgcggtcacataccgggtgtgg
tcgccgaagtccggctacccgggggacggcgcgtaccgcgacttccacacctacgaccat
ctcgtcggtctcaaaccggcccgagtgaccgggcatcatgtccccggcgaggagaaagcc
ccctacgaccccgctcgggcacagatcgccgtgcgccgagacgtggacgacttcgtgcaa
accgtgcgcgagcggctctccgccgaatccgcgcggactgggcggcccgccctggtggtc
gcggcgttcgacaccgagctcttcggccactggtggcatgaggggccgcaatggcttgag
caagtgctgaccgcgctgccggcggcgggcgtgcgggtcggcacgctcgccgaggcggcg
gcgaacggttttgtcggcgagcgcctcgaccccgcggactgctcctggggctctggaaaa
gactggcgggtgtggtccgggccgcaagtcgccgacctcgtcgagctcaacgcggacgtg
gcggaaacagcgctgcggaccgtcgacaagcggctcgccgggacgcagctgttccgggac
cgggtgagcgatcagatcctgcgcgaaacactgctcaccgtcgcgagcgactgggcattc
ctggtgagcaaggacactgccgcccagtacgcgcgggaccgggcgcacctgcacgcgcac
gcggtgcgcgagatcgcccaggccgctgagtccggccacgagggcaaagctgttcgcctc
gcccagggctggaacatcgccgacagcctgttcggccagctcgacgcgcgtcgtctcggt
ccgcgctga

DBGET integrated database retrieval system