KEGG   Segniliparus rotundus: Srot_1434Help
Entry
Srot_1434         CDS       T01238                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
srt  Segniliparus rotundus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Srot_1434
Enzymes [BR:srt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Srot_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1430406..1431302
Genome map
AA seq 298 aa AA seqDB search
MPFSSRVPAVPRVAVFGSVNQDLVLRVQRPPHPGETVMAKSVERLPGGKGANQAVAAARA
GAKVQFIGSFGEDEVGSVLRGRLRRERVGLTGSMAVPGPNGIAVILVDDTGENMIIVPPG
ANDKLTLTEAAESVLTRVDIILCQLEVPFESVVDALRVSRAAGVLTIVNFSPVPAGPFPQ
DILELADVLIVNEGEGRDLGDRINVVPHVVTTLGARGARYRGPLGEVQVPSPKVNPVDTT
GAGDVFAGVLSASWHLGPEKAVRRAAVAGALATLVSGAGNCAPTAAKIDEAAQKARQL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcctttctcttctcgcgtccccgctgttcctcgtgttgccgtcttcggcagcgtgaac
caggatcttgtgctccgcgtgcaacgaccgccgcatccaggggagacggtgatggcgaaa
tctgtggagcgcctgcctggcggcaaaggcgcgaaccaggcggtggccgccgcgcgggct
ggcgccaaagtccaattcatcggctcgttcggagaggacgaggtcggttcggtgctccga
ggccgtctgcgccgggagagagtcggtctcaccggcagcatggctgttcccggccccaat
ggcatcgcggtgatcctggtggacgacaccggtgagaacatgattatcgtgcctcctggg
gcgaacgacaaattgacgttgactgaggccgcagagagtgttttgacgagagtcgacatc
atattgtgccagttggaagtgcctttcgagtcggttgtggacgcgttgcgggtgtcccgc
gcagcaggcgttttgacgatcgtcaacttctcgccggtgccagccggaccgttcccccag
gacatcttggagctggcggacgttctgatcgtcaacgagggcgagggccgtgatctgggg
gaccgcatcaatgttgtgccgcatgtggtgacgacgctcggagcccgaggagcccgctac
cgaggacctctcggcgaagtgcaggtgccgtcaccgaaggtgaacccggtcgacaccact
ggagcaggcgacgtcttcgcgggcgtgctctcggcctcgtggcacctcgggccggagaaa
gccgtgcgccgggctgccgtggcgggggcgcttgcgacgctcgtgtcaggcgcgggcaat
tgcgcgccgacagccgcgaagatcgacgaggctgctcagaaggctcgccagctttag

DBGET integrated database retrieval system