KEGG   Segniliparus rotundus: Srot_1449Help
Entry
Srot_1449         CDS       T01238                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
srt  Segniliparus rotundus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:srt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Srot_1449
Enzymes [BR:srt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Srot_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1443081..1443680
Genome map
AA seq 199 aa AA seqDB search
MIASIRGEAVEVGADHVVVECAGLGHHVVVLPSTAAAATRGAEVRLATSFIVREDAQTLY
GFPDRETRDLFDVLRTVSGVGPKLAMAVLSVLEPVALRRAIGEGDLGALTKVPGVGKRVA
ERLALELKEKIGGPPSAAANLGAPEGSALVRQQVVDGLVGLGFPLKPAESAADSVMQENP
EASPAVALRGALAILGKKG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgtcgatccggggcgaggccgtcgaggtcggggccgaccatgtggtcgtcgaa
tgcgcggggctcgggcaccatgtcgtggtgctgccctccactgccgccgctgcgacccgc
ggagccgaagtgcggttggcgacctcgttcatcgtccgtgaggacgcccagacgctgtac
gggttccccgaccgggagacccgcgaccttttcgacgtgttgcgcaccgtctccggggtc
ggcccgaagctcgcgatggcggtgctctcggtgctggagccggtcgcgctgcgccgggcc
atcggcgagggcgacctcggcgcgctcaccaaagtccccggagtgggcaagcgtgtggcc
gaacggctggcgttggagctgaaagagaagatcggaggcccgccctcggcggccgcgaat
ctcggcgcgccagaaggcagcgcgttggtgcgacaacaagtggtggacggccttgtcggc
cttggcttcccgctcaagccggccgagtctgccgcggactcggtcatgcaagagaacccg
gaggcgagccccgccgtcgcgttgcgcggcgcgttggcgatcctggggaagaaaggatga

DBGET integrated database retrieval system