KEGG   Segniliparus rotundus: Srot_1587Help
Entry
Srot_1587         CDS       T01238                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
srt  Segniliparus rotundus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:srt01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:srt00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1578266..1579360
Genome map
AA seq 364 aa AA seqDB search
MALRLNSDPVDLTQALVDMPSESGQEAGLADAVEAALREQTSGFEVVRRGNCVLARTSAG
RPRRVLLAGHLDTVPSAGNLPSRRFVDPEHGPALAGLGTVDMKSGCAVFLHLAATLADVG
PDVTLIFYDNEEVASDRNGLGHLARDAPQWLQADVAILGEPTAGLIEAGCQGSLRLRVTT
SGKRAHAARSWLGDDAIHRLAPVLATLSAHQAREVRIDGCVYRESLSATRIGGGVAGNVI
PDEAWVEVNYRFAPDRGQDEAVAYVQGLFEHVPQTRFEVVDAAPGALPGLSHPAAAELVA
AAAGRFRAKYGWTDVSRFAAFGVPAVNFGPGDPNLAHTKEEWVPESQIHEVADVLSRYLT
APSW
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcggctgaactcggacccggtcgacctcacccaggcgctcgtcgacatgccg
agcgagtcggggcaggaggcaggcctcgccgacgccgtcgaggccgcgctgcgcgagcag
acgagtggtttcgaggttgtccgccgaggcaattgcgtgttggcccgcacgagcgcgggg
cgcccccggcgcgtgctgctcgccgggcatctggacaccgttccctcagcggggaacctt
ccttccaggcgcttcgtcgacccagagcacggcccggcgctcgcgggcctgggcacggtg
gacatgaaatcgggatgcgcggtttttctgcacctggcggccacgctcgccgacgtgggc
ccggatgtgacgctgatcttttacgacaacgaagaagtcgcctctgaccgcaatggcctc
ggccacctcgccagggatgcgccgcagtggctccaggcggacgtcgcgatcctcggcgag
ccgaccgcggggctcatcgaggcgggttgccagggctcgctgcgcttgcgagtgaccacc
tcgggcaagcgggcgcacgcggcccggtcttggctcggcgacgacgcgatccaccggctc
gcgcccgtgctcgcgacgctctcggcgcatcaggcccgcgaggtccgcattgacggctgc
gtctaccgcgaaagcctctccgcgacacggatcggcggcggggtcgccgggaatgtcatc
cccgacgaggcctgggtcgaggtgaattaccgtttcgcacctgaccggggccaagacgag
gcggtcgcgtacgtccaagggcttttcgagcatgtcccccagacacggttcgaagtcgtg
gacgcggctccgggcgcgctgccaggactttcccatcctgcggcggcggagctcgtcgcg
gctgccgcaggcaggttccgggccaagtacggctggaccgatgtctcgcggttcgccgcc
ttcggcgtccccgcggtgaatttcgggccgggcgatccgaacctcgcccacacgaaagag
gaatgggtcccggagagccagatccacgaggtggccgatgtgctctcccgatatttgacg
gctcccagctggtga

DBGET integrated database retrieval system