KEGG   Segniliparus rotundus: Srot_1644Help
Entry
Srot_1644         CDS       T01238                                 

Definition
uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
srt  Segniliparus rotundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632806..1634386
Genome map
AA seq 526 aa AA seqDB search
MDKKKTAGRVVFVGAGPGDPGLLAWRARETLIAASVVFADPGVPREILSLIGTRSSVDEE
GQTLSKPDPLVTVLPEEIDSSDVVKMLLNEAKNGNDVVRLVAGDPGSSEEVVGELLAISR
SQAPMDVIPGVSATAAAPLYAGIPLGSIHTEADLRGDVDWSALASAPGSLVLSLTAKQLA
PTGAALIDQGLPPNTPVAITSAGTTRTQKTLESTLSGLSQMGAELPAPLVLTVGRVVGQR
SKLNWWESRALFSWSVLVPRTKDQAGEMCERLVSHGAIPVEVPTIAVEPARSPAQMERAV
KGLVDGRYQWVVFTSTNAVRAVWEKFNEFGLDARAFSGVKIACVGPATAKRVREFGIEPE
LVPEGEQSSLGLLDEFPPYDEIFDPVNRVLLPRADIATETLTAGLRDGGWEVDDVTAYRT
VRAAPPPAEIREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTVETAQEF
GLRVDVQPEVASAPALVDALAEHAARLRAEGALPPPRKRSRRSSSR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagaaaaccgcgggacgggtcgtcttcgtcggcgcagggccgggcgacccc
ggcctgctggcgtggcgcgctcgcgagaccttgatcgcagcctccgtggtcttcgcggac
ccaggcgtcccacgggagatcctgtcgctgatcggcacccggagctcggtggacgaggaa
ggccagaccctctcgaaaccggacccgcttgtgaccgtgctgcctgaggagatcgactcc
tcggatgtggtgaagatgctgctgaacgaagcgaagaacggcaacgacgtcgtccgcctg
gtggctggcgacccaggttcgagcgaggaagtggtcggggagctcctcgcgatctcccgc
tcgcaagcgccgatggacgtcatccccggcgtctccgcgacggcggctgccccgctctac
gcgggcattccgctcggatcgatccacacggaggccgacttgcgcggtgacgtggactgg
agcgcgctcgcaagcgcgcccggctcgctcgtgctgagcctcaccgccaagcagctggcc
cccacgggcgccgcgctgatcgaccaagggctgccgccgaacaccccggtcgccatcacc
tccgcgggcaccacgcgcacccagaaaacccttgagtccacgctctccggcctgtcgcag
atgggagccgagctgccagccccgctcgtgctgaccgtcggcagggtcgtcggtcagcgc
tcgaagctcaactggtgggagagcagggcgctgttcagttggtcggtgctggtgccgcgc
accaaagaccaagctggcgagatgtgcgagcggctggtctcgcacggcgcgatcccggtc
gaagtgccgaccatcgcggtggagccagcccgcagccccgcgcagatggagcgcgcggtg
aaaggcttggtcgacggccgctaccaatgggtggtgttcacctccacgaacgcggtgcgg
gcggtctgggagaagttcaacgagttcggcctcgacgcccgtgcgttctcgggcgtgaaa
atcgcctgcgtcggaccagcgaccgcgaagcgtgtccgcgagttcggcatcgaaccggag
cttgtgccggaaggggagcagtcctccctcggcctcctggacgaattcccgccctatgac
gaaattttcgacccggtcaaccgggtgctgctgccccgcgccgacatcgccacagagacc
ttgacggcaggattgcgcgacggcggctgggaggtcgacgacgtgaccgcgtaccgcacg
gtgcgggctgcgccgccgccggcggagatccgcgagatgattaagaccggcggcttcgac
gcagtgtgcttcacctcgtcctcgacagttcgcaacctcgtcggcatcgcgggcaagccc
catgcccgcacgatcatcgcgtgcatcggcccgaagacagtggaaacggcgcaagagttc
ggcctgcgggtggacgtgcagcccgaagtcgcctcggctcccgctctggtggacgcgctc
gcggagcacgctgcgaggttgcgcgcggaaggcgctttgccgccgccccgcaagcgctcc
aggcgcagcagctccagatga

DBGET integrated database retrieval system