KEGG   Segniliparus rotundus: Srot_1722Help
Entry
Srot_1722         CDS       T01238                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
srt  Segniliparus rotundus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Srot_1722
Enzymes [BR:srt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Srot_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1721723..1722793
Genome map
AA seq 356 aa AA seqDB search
MSSAAGALARWISPFLAVAAVAALDCAAGAHCFADPDPDAAAHDSADDAAQENPPDNPPA
QARATDGGNPFADVPLYVNPTSAALRAANSAEPPSPELTTIANTPQAFWIDEAVPFSVVN
GYLGGAWAAGAMPVLAIYAIPHRDCGSFAAGGFATGAAYKGWIDSVADSIGASPVAIILE
PDALDMADCLSPDQREERFSLIRYAVDTLTRDPAAAVYIDGGHSRWLPAEEIASRLNQAG
VDHARGFSLNTSNFFTTEEETDYGEAVSGMTNGAHYVIDTGRNGTGPAPEAPLSWCNPSG
RAMGAQPTTDTVGEHADAYLWVKRPGESDGACNRGDPRAGVFVNQYAIDLVRNAGH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagctgctggcgcgctcgcgcggtggatctccccattcctggcggtcgcggcc
gtcgccgccctcgattgcgctgctggcgcgcattgttttgccgacccggatcccgatgcg
gcggcgcacgacagcgctgacgacgcagcccaagagaacccgccagacaacccgcctgcg
caggcacgggcaactgacgggggcaaccccttcgccgacgtgcccctctacgtgaacccc
acctccgccgcattgcgcgccgcaaacagcgccgagccgccgagccccgagctcaccacg
atcgccaacaccccccaggcgttctggatcgacgaagcggtgcccttctcagtggtcaat
ggctacttaggcggcgcgtgggcagcgggagccatgcccgtgctcgccatctacgcgatc
ccgcaccgcgactgcggaagtttcgcggcgggcgggttcgcgaccggcgcggcctacaaa
ggctggatcgactccgtcgcagacagcatcggcgcgtcccccgtcgcgatcatcctggaa
ccagacgccctcgacatggccgactgcctctcccccgaccaacgcgaagagcgcttcagc
ctgatccgctacgccgtcgacacgctgacccgcgaccccgccgcagccgtgtacatcgac
ggcgggcactcgcgctggctgcccgcagaggaaatcgcctcccggctcaaccaagccggc
gtcgaccacgcgcgggggttcagcctcaacacctccaatttcttcaccaccgaagaggag
accgactacggcgaagctgtgtccggcatgaccaatggcgcccattatgtgatcgacacg
ggccgcaacggcaccgggccagcccccgaagcgccgctcagctggtgcaatcccagcggc
cgggccatgggggcccaacccaccacagacaccgtcggcgagcacgccgacgcgtacctg
tgggtcaagcgccccggcgagtccgacggagcatgcaaccggggagacccccgggcaggc
gtctttgtcaaccagtacgccatcgacctggtccgcaacgccgggcattag

DBGET integrated database retrieval system