KEGG   Segniliparus rotundus: Srot_1787Help
Entry
Srot_1787         CDS       T01238                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
srt  Segniliparus rotundus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Srot_1787
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Srot_1787
   00630 Glyoxylate and dicarboxylate metabolism
    Srot_1787
Enzymes [BR:srt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Srot_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793337..1795517
Genome map
AA seq 726 aa AA seqDB search
MSERVNVHGFQVAKELYDFVNDEAIPGTGVDPAAYWSGFAEILTELSPRNKELLARRDEL
QSAIDEWHRARRGDFQTAEYIEFLREIGYLDAEPEDFSVTTENVDSEIAHTNGPQLVVPL
LNARYALNAANARWGSLYDALYGTDVISEDDGATKGKAYNPARGAKVIAYARKALDTIAP
LEEGSHIGSTRYTIQGGKLIVTTADGHEAGLAEPESLAGWVGEAASPTAVLLAHNGLHAE
IQIDPQSPVGQSDPAGVKDVLLESAITTIVDLEDSVAAVDAEDKVLGYRNWLGLNNGTLT
ETVVKGDSSFTRALNPDRSYTGPDGGQLVLPGRSLLFIRNVGHLMTIDAVLDPQGREVPE
GILDALVTSLVGLHGIKADNPWRNSRAGSIYIVKPKMHGPAEVAFAVQLFEKVEALLGLP
KNTIKVGVMDEERRTSANLKAALHAARERLAFVNTGFLDRTGDEIHTSIEAGPVVPKGQQ
KAQKWYNAYEDHNVDVSLHAGLAHHAQIGKGMWAMPDLMAAMVEQKIAHPRAGATTAWVP
SPTAATLHALHYHEVDVFRRQDEIAKRAPGPIEDLLTLPLGDPAKLGEAALQEQVDENCQ
SILGYVVRWIDHGVGCSKVPDIHNIGLMEDRATLRISSQTLANWLHHGVITEEQVDQSLK
RMAAVVDSQNANDPAYRPLAADFDSNIAFQAARELILKGREQPSGYTEPILHRRRKEFKA
RQTPRA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgggtcaatgtccacggtttccaggtcgccaaagagctctacgactttgtg
aacgacgaggcgatcccgggcacaggcgtggacccggcggcctactggtccggcttcgcc
gagatcctgaccgagctcagtccccgcaacaaggagctcctggcccgccgcgacgagctg
cagagcgccattgacgaatggcaccgcgcgcggcgcggcgacttccaaacagccgaatac
atcgaattcctccgtgagatcggctaccttgacgcggagcccgaggatttctccgtgacc
acggagaacgtggactcggagatcgcgcacaccaacggcccgcagctcgtggtgcccttg
ctcaacgcccgatacgcgctcaacgccgcgaacgcgcggtggggctctctctatgacgcg
ctctacggcaccgacgtgatcagcgaggacgacggcgcgaccaagggcaaggcgtacaac
ccggcgcgcggcgcgaaggtgatcgcctacgcgcgcaaggcgctcgacaccatcgccccg
ctcgaagagggcagccacatcggctccacccggtacacgatccagggcggcaagctgatc
gtgaccacggcggacgggcacgaggccggcctcgcagagcctgagagcctcgccggctgg
gtcggcgaggccgcttctccgacagcggtgctgctggcccacaacggcctgcacgccgaa
atccagatcgacccgcaaagcccggtcggccagtccgacccggcaggcgtgaaggacgtg
ctgctcgaatcggccatcaccaccatcgtggaccttgaggactcggtggccgccgtggac
gccgaggacaaagtcctcggctaccggaactggctgggcctgaacaacggcacgctgacc
gaaaccgtcgtcaaaggagacagctcgttcacgcgcgccttgaacccggaccgctcctac
acgggcccggacggggggcagctggttctgcctggccgctcgctcctgttcatccgcaac
gtcgggcacctgatgaccattgacgcggtgctggacccgcagggccgggaagtgccggag
ggcatcctcgacgcgctggtcacttcgctggtcggcctgcacggcatcaaagcggacaac
ccgtggcgcaattcgcgggccgggtcgatctacatcgtgaagccgaagatgcacggccca
gccgaagtcgccttcgccgtccagctgttcgaaaaggtcgaagcccttttgggcttgccg
aagaacaccatcaaggtcggtgtgatggatgaggagcgccgcacctcggcgaacctcaaa
gccgccctccacgccgcccgtgagcggctcgcgttcgtgaacaccggcttcctcgaccgc
accggcgacgagatccacaccagcattgaagctggccccgtggtccccaaaggccagcag
aaggcccagaagtggtacaacgcctacgaggaccacaacgtcgacgtctccttgcacgcc
gggctcgcgcaccacgcgcagatcggcaagggcatgtgggcgatgccggatctgatggcc
gcgatggtcgagcaaaagatcgcgcatccgcgcgccggcgcgaccaccgcatgggttccc
tcgccgaccgcggcgaccttgcacgcgctgcactaccacgaggtggacgtgttccgccgc
caagacgagatcgccaagcgcgcccctggtccgatcgaggatttgctcaccttgccgctg
ggcgacccggcgaagctcggcgaggccgcgctgcaggagcaggtcgatgagaactgccag
tccatcctcggatacgtggtccgctggatcgaccacggcgtcggctgctcgaaggtgcct
gacatccacaacatcggcctcatggaggaccgcgcgacgctgcgcatttcgagccagacg
ctggcgaactggctgcaccacggggtgatcaccgaggagcaggtcgaccagagcctcaaa
cggatggccgccgtggtggacagccagaacgcgaacgaccccgcctaccggccgttggca
gcggacttcgactccaacatcgccttccaagcagcgcgggagctgatcctcaaaggccgg
gagcagccgagcggctacaccgaaccgatcctgcaccggcggcgcaaagagttcaaagcg
cgccaaacaccgcgggcatga

DBGET integrated database retrieval system