KEGG   Segniliparus rotundus: Srot_1787Help
Entry
Srot_1787         CDS       T01238                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
srt  Segniliparus rotundus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:srt01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:srt00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:srt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793337..1795517
Genome map
AA seq 726 aa AA seqDB search
MSERVNVHGFQVAKELYDFVNDEAIPGTGVDPAAYWSGFAEILTELSPRNKELLARRDEL
QSAIDEWHRARRGDFQTAEYIEFLREIGYLDAEPEDFSVTTENVDSEIAHTNGPQLVVPL
LNARYALNAANARWGSLYDALYGTDVISEDDGATKGKAYNPARGAKVIAYARKALDTIAP
LEEGSHIGSTRYTIQGGKLIVTTADGHEAGLAEPESLAGWVGEAASPTAVLLAHNGLHAE
IQIDPQSPVGQSDPAGVKDVLLESAITTIVDLEDSVAAVDAEDKVLGYRNWLGLNNGTLT
ETVVKGDSSFTRALNPDRSYTGPDGGQLVLPGRSLLFIRNVGHLMTIDAVLDPQGREVPE
GILDALVTSLVGLHGIKADNPWRNSRAGSIYIVKPKMHGPAEVAFAVQLFEKVEALLGLP
KNTIKVGVMDEERRTSANLKAALHAARERLAFVNTGFLDRTGDEIHTSIEAGPVVPKGQQ
KAQKWYNAYEDHNVDVSLHAGLAHHAQIGKGMWAMPDLMAAMVEQKIAHPRAGATTAWVP
SPTAATLHALHYHEVDVFRRQDEIAKRAPGPIEDLLTLPLGDPAKLGEAALQEQVDENCQ
SILGYVVRWIDHGVGCSKVPDIHNIGLMEDRATLRISSQTLANWLHHGVITEEQVDQSLK
RMAAVVDSQNANDPAYRPLAADFDSNIAFQAARELILKGREQPSGYTEPILHRRRKEFKA
RQTPRA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacgggtcaatgtccacggtttccaggtcgccaaagagctctacgactttgtg
aacgacgaggcgatcccgggcacaggcgtggacccggcggcctactggtccggcttcgcc
gagatcctgaccgagctcagtccccgcaacaaggagctcctggcccgccgcgacgagctg
cagagcgccattgacgaatggcaccgcgcgcggcgcggcgacttccaaacagccgaatac
atcgaattcctccgtgagatcggctaccttgacgcggagcccgaggatttctccgtgacc
acggagaacgtggactcggagatcgcgcacaccaacggcccgcagctcgtggtgcccttg
ctcaacgcccgatacgcgctcaacgccgcgaacgcgcggtggggctctctctatgacgcg
ctctacggcaccgacgtgatcagcgaggacgacggcgcgaccaagggcaaggcgtacaac
ccggcgcgcggcgcgaaggtgatcgcctacgcgcgcaaggcgctcgacaccatcgccccg
ctcgaagagggcagccacatcggctccacccggtacacgatccagggcggcaagctgatc
gtgaccacggcggacgggcacgaggccggcctcgcagagcctgagagcctcgccggctgg
gtcggcgaggccgcttctccgacagcggtgctgctggcccacaacggcctgcacgccgaa
atccagatcgacccgcaaagcccggtcggccagtccgacccggcaggcgtgaaggacgtg
ctgctcgaatcggccatcaccaccatcgtggaccttgaggactcggtggccgccgtggac
gccgaggacaaagtcctcggctaccggaactggctgggcctgaacaacggcacgctgacc
gaaaccgtcgtcaaaggagacagctcgttcacgcgcgccttgaacccggaccgctcctac
acgggcccggacggggggcagctggttctgcctggccgctcgctcctgttcatccgcaac
gtcgggcacctgatgaccattgacgcggtgctggacccgcagggccgggaagtgccggag
ggcatcctcgacgcgctggtcacttcgctggtcggcctgcacggcatcaaagcggacaac
ccgtggcgcaattcgcgggccgggtcgatctacatcgtgaagccgaagatgcacggccca
gccgaagtcgccttcgccgtccagctgttcgaaaaggtcgaagcccttttgggcttgccg
aagaacaccatcaaggtcggtgtgatggatgaggagcgccgcacctcggcgaacctcaaa
gccgccctccacgccgcccgtgagcggctcgcgttcgtgaacaccggcttcctcgaccgc
accggcgacgagatccacaccagcattgaagctggccccgtggtccccaaaggccagcag
aaggcccagaagtggtacaacgcctacgaggaccacaacgtcgacgtctccttgcacgcc
gggctcgcgcaccacgcgcagatcggcaagggcatgtgggcgatgccggatctgatggcc
gcgatggtcgagcaaaagatcgcgcatccgcgcgccggcgcgaccaccgcatgggttccc
tcgccgaccgcggcgaccttgcacgcgctgcactaccacgaggtggacgtgttccgccgc
caagacgagatcgccaagcgcgcccctggtccgatcgaggatttgctcaccttgccgctg
ggcgacccggcgaagctcggcgaggccgcgctgcaggagcaggtcgatgagaactgccag
tccatcctcggatacgtggtccgctggatcgaccacggcgtcggctgctcgaaggtgcct
gacatccacaacatcggcctcatggaggaccgcgcgacgctgcgcatttcgagccagacg
ctggcgaactggctgcaccacggggtgatcaccgaggagcaggtcgaccagagcctcaaa
cggatggccgccgtggtggacagccagaacgcgaacgaccccgcctaccggccgttggca
gcggacttcgactccaacatcgccttccaagcagcgcgggagctgatcctcaaaggccgg
gagcagccgagcggctacaccgaaccgatcctgcaccggcggcgcaaagagttcaaagcg
cgccaaacaccgcgggcatga

DBGET integrated database retrieval system