KEGG   Segniliparus rotundus: Srot_1823Help
Entry
Srot_1823         CDS       T01238                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
srt  Segniliparus rotundus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Srot_1823
Enzymes [BR:srt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Srot_1823
    3.5.1.-  
     Srot_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830102..1830662
Genome map
AA seq 186 aa AA seqDB search
MATALIVVDVQNDFCEGGALAVAGGSAVAAGLAELLRSPGRGGHDLVVATRDWHIDPGAH
FSATPDYVHSWPPHCRAGSPGAELRPELADARFDAVFDKGHHSAAYSGFEGSDQSGTALE
AWLRERDVGGVDVVGVATDFCVAATALDAAKAGFATRVLLDRCAAVRPQAVPRTRQKLAR
HGVVLL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgccctgatcgtcgtcgacgtgcagaacgacttctgcgagggcggcgcgttg
gcggtggctggcgggagcgccgtcgccgcaggccttgccgagctgctgagaagtccgggc
agaggcgggcacgacctcgtcgtcgcaacgcgggattggcatatcgaccccggagcgcat
ttctccgcgacgccggactacgtccactcgtggccgccgcactgccgggcaggcagccct
ggcgccgagctgcgccccgagctcgccgacgcgcggttcgacgcggttttcgacaagggc
caccacagcgcggcgtattcgggcttcgaaggctcggaccagtccggcacggcgctcgaa
gcctggctgcgcgagcgggacgtcggcggtgtggacgtggtcggcgtcgccaccgacttt
tgcgtcgccgcgaccgcgctcgacgcggcgaaggccggattcgcgacgcgggtgttgctt
gaccgctgcgcggcggtgcgcccgcaagccgtcccgcggacacgtcaaaaactggctcga
cacggggttgttctcctgtga

DBGET integrated database retrieval system