KEGG   Segniliparus rotundus: Srot_1827Help
Entry
Srot_1827         CDS       T01238                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
srt  Segniliparus rotundus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Srot_1827
Enzymes [BR:srt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Srot_1827
Exosome [BR:srt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Srot_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1836665..1838884
Genome map
AA seq 739 aa AA seqDB search
MSTEFTHSEPEDQAAERNWAQIPAADLELLLAGAHFDPHRVYGAHPTGSGWTVRAARPLA
KSVTAVFADGSNVPLEHLGHGIFGTHIPLFNLPSYELRTEYEDGNIVLEADGYSFGPTLG
ELDLHLIGEGRHERLWEALGAHPATIGSTEGTAFRVWAPNAKGVAVVGEFNSWNPNAAPM
RSLGSSGVWEIFLPDVGAGAKYKFNVLGSDGVARLKADPFAFQAEHPPQTASVVAESDFT
WSDQAWLERRAKSAPYDEPMAVYEVHLGSFAPGLGYRELAEQIARHAADLGFTHVELLPV
AEHPFGGSWGYQVTSYFAPTSRYGSPDDFRAFVDHLHNQGLGVLLDWVPAHFPKDEWALA
RFDGSPLYEHPDPRRGEQPDWGTYVFDFGRHEVRNFLVANALYWFEEFHIDGLRVDAVAS
MLYLDYSRPEGQWAPNAYGGRENLDAVQFLQELNATVHKHHQGVVTIAEESTAWPGVTRL
TSLGGLGFGMKWNMGWMHDSLRYFGHDPIHRMYHHNEITFSLMYAWSENYVLPISHDEVV
HGKGTLWSRMPGPSRDKAAGVRSYLAYMWAHPGKKLLFMGQEFGQTAEWSAEKGLDWWQL
DGWEGELHRGVLDLVRDMGRMYREHPALWSMDASPSGFEWIDASDAQNNVLSFLRISADG
QKLACLVNLSGSDLSSYRVGLPEAGEWTEILNTDAELYAGSGKGNLGSVIAEPRPYHGRP
ASAQIRMARLSVLWLVPKR
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaattcacccacagcgagcccgaggaccaggcggcggagcgcaactgggcg
cagattcccgcagccgacctggaactgctgctcgcaggagcccacttcgacccgcatcgc
gtctacggggcgcacccgaccggctcaggctggaccgttcgcgccgcgcggcccctcgcg
aagagcgtgacggcggtcttcgcggacggctccaacgtcccgctcgaacacctcggccac
ggcatattcggcacgcacatcccccttttcaacctgcccagctacgaactgcgcacagag
tacgaggacggcaacattgtcctcgaggccgacggctacagcttcggccccacgctcggg
gaactggacctgcacttgatcggcgaaggccgccacgagcggctttgggaggcgctgggc
gcgcacccggccacaatcggctcgaccgaggggaccgcgttccgcgtgtgggctccgaac
gcgaaaggcgtcgcggtcgtcggcgagttcaacagctggaacccgaatgccgccccgatg
cgctcactcggttcgagcggcgtgtgggagatcttcctccccgatgtgggcgccggcgcg
aaatacaagttcaacgtcctcggctcggacggcgtcgcccggttgaaggcggacccgttc
gccttccaggccgagcatccgccgcagaccgcgtccgtggtggccgaaagcgacttcaca
tggtccgaccaggcatggctcgaacgccgcgcgaagagcgccccctacgacgagccgatg
gccgtgtacgaggtccacctcggctccttcgcgccaggactgggctaccgcgaactcgcg
gagcagatcgcgcgacacgcggcagacctcggcttcacccatgtggagctgctgccggtc
gccgagcacccgttcggcggatcatggggataccaggtcacctcgtacttcgcccccacc
tcgcgttatggctcccccgacgacttccgcgccttcgtcgaccatctgcacaaccagggt
ctcggggtgctcttggactgggtgcccgcgcatttccccaaggacgagtgggcgctcgcg
cgattcgacggcagcccgctgtacgaacatccggacccgcgccggggcgagcagccggac
tggggcacctatgtcttcgacttcggccgccacgaggtgcgcaacttcctcgtcgccaac
gcgctctactggttcgaagagttccacatcgacgggcttcgagtggacgcggtggcgtcc
atgctctacctcgactactcccggcccgaggggcaatgggctccgaacgcgtacggcgga
cgggagaacctcgacgcggtgcagttcctgcaagagctcaacgcgaccgtgcacaaacac
caccagggcgtggtcaccatcgccgaagagtccaccgcctggcccggtgtgacccggctg
acctcgctcggcggcctcggcttcggcatgaagtggaacatgggctggatgcacgactcg
ttgcgctatttcggccacgacccgatccaccggatgtaccaccacaacgagatcacgttc
tcgctcatgtacgcgtggagcgagaactacgtcttgcccatcagccacgacgaggtcgtg
cacggcaaagggacgttgtggtcgcgcatgccagggccgagccgcgacaaagccgcgggc
gttcgctcctacctcgcctacatgtgggcgcaccctgggaagaagctgctcttcatgggc
caagagttcggccaaaccgccgaatggtccgcggaaaaaggcctcgactggtggcagctg
gacggctgggagggcgaactgcaccggggtgtgctcgacctcgtccgcgacatgggccgg
atgtaccgcgaacacccggcgctgtggagcatggacgcctctccctcgggcttcgagtgg
atcgacgcgagcgacgcgcaaaacaatgtgctctctttcctgcggatatcagcagacgga
caaaagctcgcgtgcctggtgaacctgtccgggtcggacctgtcgagctaccgggtgggg
ctcccggaggcgggcgagtggaccgaaatcctcaacacggacgccgaactgtacgcgggc
tcgggcaaaggcaacctggggtcggtcatcgcggagccgcggccgtaccacggaagaccc
gcttcggcgcagatccgcatggcaaggctctcggtgctctggctcgttcccaaacgctag

DBGET integrated database retrieval system