KEGG   Segniliparus rotundus: Srot_1991Help
Entry
Srot_1991         CDS       T01238                                 

Definition
(GenBank) dihydrofolate reductase region
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
srt  Segniliparus rotundus
Pathway
srt00670  One carbon pool by folate
srt00790  Folate biosynthesis
srt01100  Metabolic pathways
Module
srt_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Srot_1991
   00670 One carbon pool by folate
    Srot_1991
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Srot_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADG98448
UniProt: D6Z918
Position
complement(2014881..2015369)
Genome map
AA seq 162 aa AA seqDB search
MAVGVLWAQGRNGVIGIDGELPWSIPEDMRRFRQLTVGHTVVMGRKTWDSLPARFRPLPE
RTNVVLSRDRGYTAQGAQVAHDVVTATAPGRAGETVWVIGGGEVYAKAVHLAAIAEITEV
DFEVEGDVYAPQLGVGWRVAAEGPWQRSESGLRYRFTTFRRA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcggtgttctttgggcgcaggggcgcaacggggtgatcggcattgatggcgag
ctgccgtggtcgatccccgaggacatgcgcaggtttcgccagctcacggtcggacacacg
gtggtcatgggccgcaagacctgggactcgctgcccgcgcggttccgcccgttgcccgaa
cggaccaatgtggtgctctccagggaccggggttacaccgcccaaggcgcgcaggtcgcg
catgacgtcgtcactgcgaccgctccgggccgggcgggggagacagtctgggtcatcggc
gggggggaggtctacgccaaggctgtgcatctcgctgcgatcgccgagatcaccgaggtg
gacttcgaagtcgaaggcgatgtgtacgcccctcagctcggcgtgggctggcgggtcgcc
gcagaaggcccctggcagcgctccgagtcggggctgcggtatcgcttcaccaccttccgc
agagcctga

DBGET integrated database retrieval system