KEGG   Segniliparus rotundus: Srot_2097Help
Entry
Srot_2097         CDS       T01238                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
srt  Segniliparus rotundus
Pathway
srt00020  Citrate cycle (TCA cycle)
srt00310  Lysine degradation
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Srot_2097
  Amino acid metabolism
   00310 Lysine degradation
    Srot_2097
Enzymes [BR:srt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Srot_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADG98552
UniProt: D6Z9C2
Position
2124560..2126317
Genome map
AA seq 585 aa AA seqDB search
MAISVRMPALGESVTEGTVTRWLKNEGDTVATDEPLLEVSTDKVDTEIPSPGAGVLQKIV
APEDAVVEVGGELAVISEDGESAPSASEAEPAQQEEAPEPQEPASEEATPQEPKADDAPA
AQSAPASDASGTTVTMPTLGESVTEGTVTRWLKQEGDTVEVDEPLLEISTDKVDTEIPSP
AAGVLQKIIAAEDAVVEVGGDLAVIGSGSAPAAAQETKSPEPENAPAPKTEEPQEQEKPA
PAAPTQEAPAPVEEKPAPAKEEPARAAEAAQDEADGANPYVTPLVRKLAREHGVDLATIT
GSGIGGRIRKQDVLDAAESKKAPPEPAQKTPAAPSSPEASSALAHLRGTTQKVNRVRQIT
AKKTRESLLSTAQLTQTFEVDMTKIAALRGKAKAGFQEREKVNLTFLPFFAKAVVEALKA
HPNVNASFDEEAKEITYHDAEHLGIAVDTEQGLLSPVIHNAGDLSLAGLARAIADIAARA
RSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVRRPVVVKDDTGEEV
IAIRSMVFLPLTYDHRLIDGADAGRFLTTVKHRLEEGAFEADLGL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctatctcggttcggatgcctgcgctcggcgagagcgtcaccgaagggaccgtcacc
cgctggctcaagaacgagggcgacacggtcgccaccgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgagatcccctcccccggcgcaggcgtgctgcagaagatcgtc
gctccagaggacgccgtggtcgaggtcggcggagagctcgccgtgatctccgaggacggc
gaatccgccccctccgcttctgaggcggagcccgcccagcaggaagaagcgccggagccc
caggagcccgcttccgaagaggccacgccgcaagagcccaaggccgacgacgcccctgcc
gcccagtccgcgcccgcttctgatgcttccggcaccactgtgaccatgccgaccctcggc
gagtccgtcactgagggcacggtcacccgctggctcaagcaagagggcgacacggtcgag
gtcgacgagccccttttggagatctccaccgacaaggtcgacaccgagatcccctccccc
gccgcaggcgtgctgcagaagatcatcgccgccgaggacgctgtcgtcgaggtcggcggc
gacctcgccgtcatcggctcggggtcagccccggccgccgcgcaagaaaccaagagcccc
gagccggaaaacgcccccgcgccaaagacggaggagcctcaggagcaagagaagcccgcg
cccgccgccccgacgcaggaggctcccgcccctgttgaggaaaagcccgcccccgcgaaa
gaggagcccgctcgcgccgcagaggccgcgcaagacgaggccgacggcgcgaacccctat
gtcaccccgctcgtgcgcaagctggcccgcgagcacggcgtggacctggcgacgatcacc
ggttccggcatcggcgggcgtatccgcaaacaagacgtgctcgacgccgccgaaagcaaa
aaagcaccgcccgaacccgcccagaagactccggctgcaccttcgtccccggaggcttcc
tccgccctcgcccatctgcgcggcaccacccaaaaagtgaaccgggtccggcagatcacc
gcgaaaaagacacgagagtccctgctctccaccgcgcagctcacccagaccttcgaggtc
gacatgaccaagatcgcggccttgcggggcaaagccaaggcaggcttccaagaacgcgag
aaagtcaacctcactttcctgcccttcttcgcgaaagccgtggtcgaggcgctcaaagcg
catccgaatgtgaacgcctccttcgatgaggaggccaaagagatcacctaccacgacgcc
gaacatctcggcatcgcggtggacaccgagcagggcctgctctcaccggtgatccacaac
gccggagacctctccttggccgggctcgcccgagccatcgccgacatcgcggcgcgggcc
cgctctggcaatctcaagcctgacgagctgtcgggcggcaccttcaccatcacgaacatc
ggcagccaaggcgcgctcttcgacaccccgatcctggtgccgccgcaggcggccatgctc
ggcaccggcgcgatcgtccggcgccccgtcgtcgtgaaagacgacacgggcgaagaagtc
atcgcgatccgctcgatggtgttcctgccgctcacctacgaccaccgcctcatcgacggc
gccgacgccgggcgtttcctcacgacggtcaaacaccgcctcgaagaaggagccttcgag
gcggatctcggcctctga

DBGET integrated database retrieval system