KEGG   Segniliparus rotundus: Srot_2152Help
Entry
Srot_2152         CDS       T01238                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
srt  Segniliparus rotundus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Srot_2152
Enzymes [BR:srt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Srot_2152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2175043..2176443)
Genome map
AA seq 466 aa AA seqDB search
MRWWRHDTEQSGHAAHRWNSAFSHLWGDTGREKMSEHFDAVSIIADKRDGRALSDGQIDW
VISNFARGEVADEQMAALAMAVLLNGLNAAELSRWTQAMVGSGERLDLASVSRPTVDKHS
TGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHTGGTLDKLESIPGWSPHLSPEAFLAQL
EQIGAVVAAASGDLAPADRKLYALRDVTGTVESIPLIASSIMSKKIAEGTGALVLDVKVG
SGAFMRDLAQARELAQAMVRIGKDAGVATVALLTGMDVPLGRAVGNAVEVAEAVQVLRGG
GPADVRELVIALAEEMLRLVGRDPESPESSPREALDSGRAHAAWRGMVQAQGGDPDAPLP
EAAHREVLVAPRSGRVVAADARGVGVAAWRLGAGRERQGDPVSFGAGVLLAKRPGDLVEA
GEPLATMLADDRERFGWARDVLANSFAIADHEAAFTAPALILDRVG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggtggaggcatgacaccgagcagagcggccacgccgcgcatcgctggaacagc
gcgttctcgcatctgtggggcgatacggggcgtgagaagatgagcgagcatttcgacgcg
gtctccatcatcgcggacaagcgcgacggcagggcgctctcagacggccaaatcgactgg
gtgatctcgaatttcgcgcggggcgaggtcgcggacgagcagatggccgccctggcgatg
gcggtgttgctgaacgggctgaacgcggccgagctcagccgctggacccaggcgatggtc
ggctccggcgaacggctcgacctcgccagcgtcagcaggccgaccgtggacaagcactcc
accggcggggtcggggacaaaatcaccctcccgctcacacctctcgtcgcggcgtgcggc
gcggcggtgccgcagctgtccggcagggggctcggccacaccggcggcaccctggacaag
ctggagtccatccccggctggtcgccgcacctctcgcccgaagccttcctcgcccagttg
gaacagatcggcgcggtggtcgccgcagcgtcgggcgatctggctcctgcggaccgcaag
ctctacgcgttgcgggacgtgaccggcaccgtggagtccatcccgttgatcgcgagctcg
atcatgagcaagaagatcgccgaaggaacgggggcgttggtcctcgacgtgaaagtgggc
tcgggggcgttcatgcgcgatctggcccaggcccgcgagctggcacaggccatggtgcgc
atcggcaaggacgcgggggtggccaccgtggcgctgctcaccggcatggacgtccccctc
gggcgcgcggtcggcaacgccgtcgaagtcgccgaggcggtccaagtgctgcgcggcggc
ggcccggcggacgtgcgagagctcgtgatcgccctcgccgaagagatgctgcgcctcgtc
gggagagacccggaatccccggagagctccccgcgcgaggcgctcgactccggccgggcg
cacgccgcgtggcgcggcatggtccaggcccagggcggcgacccggacgcccccctcccc
gaggcggcccaccgagaagtcctcgtcgccccgcgctctggcagagtggtcgccgccgac
gcgcgcggtgtcggcgtcgccgcatggcgcctcggcgcgggccgggagcgccaaggcgac
ccggtgtccttcggcgccggggtcttgctcgcgaaacgtccgggcgatctggtcgaagcg
ggggagccgctggcgacgatgctcgccgacgaccgggagcgtttcggctgggcccgagac
gtgctcgccaacagtttcgccatcgccgaccacgaggcggcgttcacggctcccgccctc
atcctggaccgcgtcggctga

DBGET integrated database retrieval system