KEGG   Segniliparus rotundus: Srot_2155Help
Entry
Srot_2155         CDS       T01238                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
srt  Segniliparus rotundus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Srot_2155
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Srot_2155
   00650 Butanoate metabolism
    Srot_2155
  Energy metabolism
   00190 Oxidative phosphorylation
    Srot_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2177580..2177999
Genome map
AA seq 139 aa AA seqDB search
MTATLTRSAAPTPGPAKKSNFWRHFERHAWFFMRISGVALLLLALGHMLIMLTFDPSGPN
PGVHRVDASFVAARWHQPFWRGWDLIMLWLAQLHGANGVRVVIDDYARRPATRLILRTLL
AVSAFITLAAGTYALIAFS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacgctcacccgctctgccgcgccgacgccgggcccggcgaagaaaagcaac
ttctggcggcacttcgagcgccatgcctggttcttcatgcggatctccggcgtcgcgctg
ctgctgctcgccctcggccacatgctcatcatgctcacattcgacccctccgggcccaat
ccgggcgtgcaccgggtggacgcctcgttcgtcgcggcgcgctggcaccagccgttctgg
cggggctgggacctcatcatgctctggctcgcccaactgcacggcgcgaacggcgtccgg
gtcgtcatcgacgactacgcgcgcaggcccgcgacacgcctcatcctgcggaccctgctc
gcggtgtccgccttcatcactctggccgcaggcacctacgccctgatcgcgttctcgtga

DBGET integrated database retrieval system