KEGG   Segniliparus rotundus: Srot_2155Help
Entry
Srot_2155         CDS       T01238                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
srt  Segniliparus rotundus
Pathway
srt00020  Citrate cycle (TCA cycle)
srt00190  Oxidative phosphorylation
srt00650  Butanoate metabolism
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01200  Carbon metabolism
Module
srt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Srot_2155
   00650 Butanoate metabolism
    Srot_2155
  Energy metabolism
   00190 Oxidative phosphorylation
    Srot_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ADG98607
UniProt: D6Z9T7
Position
2177580..2177999
Genome map
AA seq 139 aa AA seqDB search
MTATLTRSAAPTPGPAKKSNFWRHFERHAWFFMRISGVALLLLALGHMLIMLTFDPSGPN
PGVHRVDASFVAARWHQPFWRGWDLIMLWLAQLHGANGVRVVIDDYARRPATRLILRTLL
AVSAFITLAAGTYALIAFS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgacgctcacccgctctgccgcgccgacgccgggcccggcgaagaaaagcaac
ttctggcggcacttcgagcgccatgcctggttcttcatgcggatctccggcgtcgcgctg
ctgctgctcgccctcggccacatgctcatcatgctcacattcgacccctccgggcccaat
ccgggcgtgcaccgggtggacgcctcgttcgtcgcggcgcgctggcaccagccgttctgg
cggggctgggacctcatcatgctctggctcgcccaactgcacggcgcgaacggcgtccgg
gtcgtcatcgacgactacgcgcgcaggcccgcgacacgcctcatcctgcggaccctgctc
gcggtgtccgccttcatcactctggccgcaggcacctacgccctgatcgcgttctcgtga

DBGET integrated database retrieval system