KEGG   Segniliparus rotundus: Srot_2173Help
Entry
Srot_2173         CDS       T01238                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
srt  Segniliparus rotundus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:srt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2200482..2201465
Genome map
AA seq 327 aa AA seqDB search
MTDAPDGSREILGPFDGFTRPRFAEPSTFARLPRLDQVGHADIVVLGVPFDGGTSYRPGA
RFGPGHVRASSKLIRQYHPPLDVYPFQNWQVADAGDLGIGPYSIVDALAVIEEAADELIG
GGATVLAVGGDHTVALPLLRSTVKKHGPVAVLHFDAHLDTWDSYFGADYTHGTPFRRASE
EGLIDLNRSLHVGIRGSLAGREDLQDDAVLGFQIIHTDDFETGTVAQIVERMRKRLGGAD
GSGGPVYISVDIDVLDPAHAPGTGTPEAGGLTTRELQHALRGLVGLPVVGADVVEVAPAY
DHAEITGIAAAHVVYELLALLTKTQFG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcaccggacggttcccgcgagatcctcggcccttttgacggtttcacacgc
cccaggttcgccgaaccttccacctttgcccggcttccccgcctcgaccaggtggggcat
gcggacatcgtggtcctcggcgtgcctttcgacggaggcacgagctatcggccaggcgcc
cggttcggccccggccacgtccgggcctcctcgaaactgatccgccaataccatcccccg
ctcgacgtctacccgttccagaactggcaggtggccgatgcgggcgacctcgggatcggc
ccgtacagcatcgtggacgcgctcgccgtgatcgaagaggcggccgacgagctgatcggc
ggcggggccaccgtgctcgccgtcggcggggaccacaccgtcgcgttgccgttgttgcgc
tcgaccgtcaagaagcacggcccggtcgccgtgctgcacttcgacgcgcacctggacacc
tgggacagctacttcggcgcggactacacccacggcacgcctttccgacgggcgagcgag
gaaggcctcatcgacctcaaccgctccctgcacgtcggcatccgggggtcgctcgccgga
cgtgaggaccttcaggacgacgcggtcctcgggttccagatcatccacaccgacgacttc
gaaaccggcacggtcgcgcagatcgtcgagcggatgcgcaaacggctcggtggagccgac
gggtcgggcggcccggtctacatctccgtggacatcgacgtgctcgaccccgcgcacgcc
cccggcacgggcaccccggaggcgggcgggctcaccacccgcgagttgcagcacgcgctg
cgcgggctcgtggggctgcccgtggtcggcgcggacgtggtggaagtcgctccggcctac
gaccacgccgagatcaccgggatcgcggcggcgcatgtcgtgtacgagcttctcgccttg
ctgaccaagacccagttcggctga

DBGET integrated database retrieval system