KEGG   Segniliparus rotundus: Srot_2248Help
Entry
Srot_2248         CDS       T01238                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
srt  Segniliparus rotundus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:srt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2276589..2277992
Genome map
AA seq 467 aa AA seqDB search
MAKLVKVTFEEHAKPTTLGELRASGHRERSVKQEIAENLLAALKEGRNPWPGLFGLENTV
LPQLERALIAHHDFVLLGERGQGKTRLLRSLAGLLDEWTPVIQGSELGEHPYRPITPASI
RRAAELGDGLPVAWKHRSERYTEKLATPDTSVGDLIGDIDPVKVAEGRSLGDPDTIAYGL
VPRAHRGIVAINELPDLAERIQVAMLNVMEERDIQVRGHTLRLPLDVLMTASANPEDYTN
RGRIITPLKDRFGAEIRTHYPADLDAEVEVIEQEASLSANVPRYLAEIVARCTQLLRESS
SVDQRSGVSARFSIAAAETVAAAALRRAALTGETEAVARIVDLGSVVDVLRGKIEFESGE
EGREQEILSHLVRRATADVARRHLAGVDVGPLLAAVENGQSVTTGEVVPAKDVLASVENL
AVVDVVARQLGAASTGERAGAVELALEALYLARRLDKVSDSKTSVYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtggctaagctggtcaaggtgacgtttgaggagcacgcgaaaccgacgaccctgggagag
ctccgagcctcggggcacagagagcgatcggtgaagcaagagatcgcggagaacctcttg
gcggcgctgaaggaagggcgaaacccttggccagggctgttcggactcgagaacacggtc
ctcccccagctcgaacgcgcgctcatcgcgcaccacgactttgtgctcctcggcgagcgc
ggccaaggcaagacccgcttgctccgctccctggcagggctcctggacgagtggaccccg
gtgatccaaggttccgagctcggcgagcacccctaccggccgatcacccccgcgtcgatc
cggcgcgccgccgaactcggcgacggcctgccggtggcctggaagcaccgcagcgagcgg
tacaccgaaaaactcgcgaccccggacacttcggtgggcgacctgatcggcgacatcgac
ccggtgaaagtcgccgagggccgcagcctcggcgatcctgacaccatcgcctacggcctg
gtccccagggcgcaccgagggatcgtcgcgatcaacgagctgcccgacctcgccgaacgc
atccaggtcgccatgctcaacgtcatggaggagcgcgacatccaggtccggggccacacg
ctgcgcctgcccttggacgtgctcatgacagcctcggcgaacccggaggactacacgaac
cgcggccggatcatcacgccgctcaaggaccgcttcggggcagagatccgcacccactac
cctgccgatctggacgcggaagtcgaagtgatcgagcaggaggcgagcctgtccgcgaac
gtgccccgctacctcgccgaaatcgtcgcgcgctgcacgcagctcctgcgcgagtccagc
tctgtcgaccaacgctccggggtctccgcccggttctcgatcgccgccgcggagacggtg
gcggccgccgcgctgcgccgcgccgccctgaccggcgagacggaggccgtggcccgcatc
gtggacctcggctcggtcgtcgacgtgctgcgggggaaaatcgaattcgaatccggcgaa
gagggccgcgagcaggaaatcctcagccaccttgtgcgccgggcgaccgccgacgtcgcg
cgtcggcatctcgcaggcgtcgacgtcgggccgctcctggccgcggtggagaacgggcag
agcgtgaccaccggcgaggtggtcccggcgaaagacgtgctcgcctcggtggaaaatctc
gccgttgtggacgtcgtcgcccgccagctcggcgcggcgagcaccggcgagcgggcgggc
gcggtggaactggctctggaagcgctctacctcgcgcgcaggctcgacaaagtctccgac
tcgaagacctcggtgtatggctga

DBGET integrated database retrieval system