KEGG   Segniliparus rotundus: Srot_2262Help
Entry
Srot_2262         CDS       T01238                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
srt  Segniliparus rotundus
Pathway
srt00521  Streptomycin biosynthesis
srt00523  Polyketide sugar unit biosynthesis
srt01130  Biosynthesis of antibiotics
Module
srt_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Srot_2262
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Srot_2262
Enzymes [BR:srt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Srot_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADG98712
UniProt: D6ZA42
Position
complement(2294009..2294608)
Genome map
AA seq 199 aa AA seqDB search
MTQWRELPIAGAWEIIPELHPDDRGVNAELFRASALREATGRDFTTAQCNCSISKAGVLR
GVHLALSPDGALEGGQEKYVTATSGMAFDVVVDVRSGSPTFGAWEAVLLSGERRNAVLLS
AGLGHAVLALEDDTVLTYLCSQEYDPGRERALDALDPALAIAWPRTDSRGRTIDFLRSDR
DRAAPSLAQAVASGALPAR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagtggcgggaattgcccatcgcgggagcctgggagatcatcccggagctgcat
cctgacgaccggggcgtgaacgcggagcttttccgggcgagcgcccttcgcgaggcgacc
ggtcgagatttcacgacggcccagtgcaactgctccatttcgaaggcgggggtgctgcgc
ggcgtccacctggccctcagcccggacggcgcgctcgaaggcggccaagagaagtatgtg
acggcgacttcggggatggctttcgacgtggtggtggatgtgcgttccggctcgccgacg
ttcggcgcttgggaagcggtgctgctcagcggcgagcggcgcaacgctgtgctgctctcg
gccgggctcggccacgccgtcctcgctcttgaggacgacacagttctgacgtatctctgt
tcccaagagtacgaccctgggcgtgagcgggcgctcgacgcgctcgaccccgcgctcgcg
atcgcctggccgcgcacggactcccgcggccgcacgatcgatttcttgcggtccgaccgc
gaccgcgccgcgccgagcctcgcccaggccgtggcttcaggagcgcttccagcgcgctag

DBGET integrated database retrieval system