KEGG   Segniliparus rotundus: Srot_2370Help
Entry
Srot_2370         CDS       T01238                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
srt  Segniliparus rotundus
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Srot_2370
Enzymes [BR:srt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Srot_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2397060..2399504
Genome map
AA seq 814 aa AA seqDB search
MTTLAVDPPAAERSAGQPLTPERLRQVDAQWRAANYLTVGQIYLMGNPLLREPLSPEQIK
PRLLGHWGTSPGLNFVYAHLNRAIVEHGSNLMYVIGPGHGGPALFANTWLEGSYSEVRPD
IPRNEEGMRTLFHEFSFPGGVPSHVAPEVPGSIHEGGELGYSLAHAYGAVLDNPDLVTAC
VVGDGEAETGPLATSWHANKFLDPAHDGAVLPILHLNGYKIANPAVLARIPKGELDALLR
GYGHDPIHVEGSDPAVLHQQMAAALDEALGRIQTFQFLARFGRPATHESDRPAWPMIVLR
TAKGWTGPAQVGGVPVEGTWRAHQVPLPGVRENAAHLRQLEAWMRSYRPEELFDACGSPA
PDVVALIPSGGARMGSNRHANGGRILRPLELPEPGEFSVAVGSPGGRCAEPTRQLGKYLR
AVMERNAAERNFRLFGPDETASNRLDDVYTVTDKQWNAQTVSTDEHLAHDGRVLEVLSEH
LCQGWLEGYLLTGRHGLLSCYEAFAHIVDSMVNQHAKWLKVSKELPWRAPIASLNYLITS
HVWRQDHNGFSHQDPGFIDHVANKRAEVARIYLPPDANTLLCVAAHCLASRDYINVIVAG
KNDAPVWLTAEEAALHCARGAGVFEWASNDADGEPDVVLACAGDVPTVEVLAAVSILRER
LADLRVRVVNVVDLFRLQPADQHPHGMPDQEYDALFTADKPVIFAFHGYPALIHRLTYRR
GGHSNLHVRGYLEEGTTTTPFDMLVLNKADRFQLVIDVVDRAPELRSPELSERAAQLRQD
MQGAHQRHRAWIRAHGEDLPDVREWTWHMKGGSA
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcttgccgttgacccgcccgccgcagaacgatctgcggggcagccgctcacc
ccggagcggctgcggcaagtcgacgcgcaatggcgcgcggcgaactacctgaccgtgggc
cagatctacctcatgggcaatccgctgctgcgcgagcccctgagtcctgagcagatcaaa
ccccggctgctggggcattggggcacctccccgggcctgaacttcgtctacgcccatctc
aaccgggccatcgtcgaacatgggtcgaacctgatgtacgtgatcggaccgggccacggg
ggtccggcgttgttcgcgaacacctggctcgaaggcagctacagcgaggtgcggcccgac
atcccccggaacgaagaaggcatgcggacgctgttccacgagttctccttcccaggcggg
gtcccgagccatgtggctccagaggtgcccgggtctattcatgagggcggcgagttgggg
tattccttggcgcacgcctacggcgcagtgctcgacaatccggacctggtcacggcctgc
gtggtcggcgacggggaggcggagaccggaccgctcgccacgagctggcacgcgaacaag
ttcctcgaccccgcgcacgacggcgcggtgttgccgatcctgcacctgaacggttacaag
atcgcgaaccccgcagtgctcgcccgaatcccaaagggggagctcgacgcgttgctgcgc
ggctacggccacgacccgatccacgtggagggctccgacccggcggtgctgcaccagcag
atggccgccgcgctggacgaggcgctcggcaggatccagaccttccagttcctcgcgcgc
ttcggcaggccggcgacgcacgagagcgaccgcccggcgtggccgatgatcgtgctgcgc
accgccaagggctggaccgggcccgcgcaggtgggcggagtcccggtggagggcacatgg
cgcgctcaccaggtccccttgcccggggtccgggagaacgccgcgcatctgcgacagctg
gaggcgtggatgcgctcataccgccccgaggagttgttcgacgcgtgtggcagccctgcg
ccggacgtcgtcgcgttaatcccctccggcggggcgcgcatgggctccaaccggcacgcc
aacggcgggcggatcctgcgcccgctcgaactccccgagccgggggagttctccgtcgcg
gtcggcagtccgggcgggagatgcgcggagccgaccaggcaattgggcaaatacttgcgg
gcggtgatggagcgcaacgccgccgagaggaacttccggctgttcggaccggacgagacc
gcgtcgaaccggctcgacgacgtgtataccgtcaccgacaagcagtggaacgcgcagact
gtctcaaccgacgagcacctcgcccacgacggtcgggtgctggaagtgctctccgagcac
ctgtgccaaggctggttggagggctacctcctaactggcaggcacgggctcctctcctgc
tacgaggcgttcgcccacatcgtggactcgatggtcaatcagcacgccaaatggttgaaa
gtgtccaaagagctgccgtggcgtgcgccgatcgcctcgctcaactacctgatcacctcg
cacgtttggcgccaagaccacaacgggttctcccatcaggacccgggtttcatcgaccat
gtggcgaacaaacgcgccgaggtggcccggatctacctcccgccggacgcgaacacgctg
ctgtgcgtcgcggcgcactgtttggccagccgcgactacatcaacgtgatcgtggcgggg
aagaacgacgcccccgtgtggctgaccgccgaagaagccgcgttgcactgcgcgcggggt
gccggagtcttcgaatgggcctccaacgacgcggacggcgagccagacgtggtcttggcc
tgcgcgggcgacgtgcccaccgtcgaggtgctcgccgccgtctcgatcctgcgcgagcgc
ctggcggatctgagagtccgggtggtgaacgtggtggaccttttccggctgcaacccgcc
gaccagcacccgcacgggatgcccgaccaagagtacgacgccctgttcaccgccgacaag
ccggtgatcttcgccttccacggctaccctgcgctcatccaccggctgacgtaccgtcgc
ggcggacacagcaacctgcatgtgcgcggatacttggaggagggcaccacgaccacgccc
ttcgacatgctggtgctcaacaaggccgaccgcttccagctcgtcatcgacgtcgtggac
cgcgcccctgaactgcgcagtcctgaattgagcgaacgagctgcgcagctgcggcaggac
atgcagggcgcgcaccagcggcatcgggcatggatccgcgcgcacggcgaagacctgccc
gacgtgcgagaatggacgtggcatatgaaaggaggcagcgcgtga

DBGET integrated database retrieval system