KEGG   Segniliparus rotundus: Srot_2462Help
Entry
Srot_2462         CDS       T01238                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
srt  Segniliparus rotundus
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Srot_2462
  Amino acid metabolism
   00380 Tryptophan metabolism
    Srot_2462
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Srot_2462
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Srot_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2513970..2515385
Genome map
AA seq 471 aa AA seqDB search
MTDPIAAEKPTRAGLPHPRFRLPLLGDLLRLDLAKPTQSLVPLSHEAGPVFEQVFFGFPL
RVVAGAREIEEVNNEEAWEKHVGPALHKLRPMAGDGLFTAYNREPNWQKAHNVLMPAFSR
SAMVNYHASIRGAVEELVEVWAEDARSGAWVDVVDSMNKLTLEVISRAGFGHSFNLLSSR
EESPLIAAIVRELTYAQRRTDVLPWFERMFLRKREHQHQADMTLAKRTVDDIVGERRRNP
HESPTDILDLMLTAVDPETGEQLDDANIRNQILTFLIAGSETSANAVSFALHHLAEQPEL
ARQAQAEVEARWPGRDFPDIGYEDVAKLRYLRRVTDETLRLWPVAPGYFRRARKDTTVGG
HAFKQKDWVFVLLIGAHRDPASWGADADRFNPDRFSPENIRSLPPRIYKPFGTGPRACIG
RQFALHEIILTLAAILHQFDLEPDPGYTITATEHPTLKPAGLRLRLHTRSR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacccaatcgcagccgaaaaacccacgagggcagggttgccgcatccgcgtttc
cgactgccgctcctcggcgacctgctgcggctggacctggccaaacccacccaaagcttg
gtcccgttgtctcatgaagctggcccagtcttcgagcaggtcttcttcggcttcccgctc
agagtcgtcgcgggcgctcgggagatcgaagaggtcaacaacgaggaggcgtgggagaag
cacgtcggcccggctctgcataaactgcgcccgatggcaggagacgggctgttcaccgcc
tacaaccgggagccgaactggcagaaggcgcataacgtgttgatgcccgcgttctcgcgc
tcggccatggtcaactaccacgcgagcatccggggcgcggtcgaggagctggtcgaagtc
tgggccgaggacgcgaggagcggcgcctgggtcgatgtggtcgacagcatgaacaaactc
acgctggaggtcatctccagagcaggcttcggccactctttcaaccttttgtcgagccgg
gaggagagcccgctcatcgccgcgatcgtgcgagaactgacatacgcgcaacgcaggacc
gacgtgctgccctggttcgagcggatgttcctgcgcaagcgggaacatcagcaccaggcc
gacatgacgctcgcgaagcgcacggtcgacgacatcgtcggcgagcgcaggcgcaacccg
cacgagagcccgacggacatcctcgacctcatgctcacggccgtcgacccggagaccggc
gaacagctcgacgacgcgaacatccgcaaccagatcctcaccttcctcatcgccggcagc
gagaccagcgcgaacgccgtgtccttcgcactgcaccatctcgcggaacaaccggagctc
gcgagacaggcccaggcggaggtggaagcccgctggccgggacgggacttcccggacatc
ggctacgaagacgtcgcgaagctccgatacctgcgccgcgtcaccgacgagacgctgcga
ctgtggccggtcgcgccaggatacttccgccgcgcgaggaaagacacgaccgtcggaggc
cacgccttcaaacagaaagactgggtgttcgtcctgctcatcggggcgcaccgggacccg
gcctcgtggggggcggacgctgatcggttcaacccggaccgcttctcccccgagaacatc
aggagcctgccgcctcgcatctacaaaccgttcggcacgggcccgagggcgtgcatcggc
cgccagttcgccctccacgagatcattctgaccctggccgcgatcctgcaccagttcgac
ctcgagcccgacccggggtacacgatcacggcgaccgagcaccccaccctcaaaccagcc
ggactcaggttacgcttgcacacgcgaagccgctga

DBGET integrated database retrieval system