KEGG   Segniliparus rotundus: Srot_2536Help
Entry
Srot_2536         CDS       T01238                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
srt  Segniliparus rotundus
Pathway
srt00071  Fatty acid degradation
srt00280  Valine, leucine and isoleucine degradation
srt00281  Geraniol degradation
srt00310  Lysine degradation
srt00362  Benzoate degradation
srt00380  Tryptophan metabolism
srt00410  beta-Alanine metabolism
srt00640  Propanoate metabolism
srt00650  Butanoate metabolism
srt00903  Limonene and pinene degradation
srt00930  Caprolactam degradation
srt01040  Biosynthesis of unsaturated fatty acids
srt01100  Metabolic pathways
srt01110  Biosynthesis of secondary metabolites
srt01120  Microbial metabolism in diverse environments
srt01130  Biosynthesis of antibiotics
srt01200  Carbon metabolism
srt01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Srot_2536
   00650 Butanoate metabolism
    Srot_2536
  Lipid metabolism
   00071 Fatty acid degradation
    Srot_2536
   01040 Biosynthesis of unsaturated fatty acids
    Srot_2536
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Srot_2536
   00310 Lysine degradation
    Srot_2536
   00380 Tryptophan metabolism
    Srot_2536
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Srot_2536
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Srot_2536
   00281 Geraniol degradation
    Srot_2536
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Srot_2536
   00930 Caprolactam degradation
    Srot_2536
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Srot_2536
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Srot_2536
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Srot_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADG98973
UniProt: D6ZBM1
Position
complement(2595722..2597881)
Genome map
AA seq 719 aa AA seqDB search
MSDYANTIRWEQDADGVVTLVLDDPNQSANTMNQDFGKSLAATVERLESEVEKIPGVVIT
SAKKTFFAGGDLNDLIKLQPEDAARFTDELNTLKGYLRRLEKLGKPVVAAINGAALGGGL
EIALATHRRIVADVKGVQLGLPEVQLGLLPGGGGVTRTVRLLGIQNALMNVLLQGPRLNP
SKAKDLGLVHELVGSVDELVPAAKAWIKANPEGGVQPWDQQGYKIPGGSPSTPSFAQFAP
AIPANLRKQTHGAPMPAPRAIVAAAIEGAQVDFDNASLIETRYMVSLAVGQVAKNMTKAF
FFDLQHINSGGSRPKDEPKHTPKKIGVLGAGMMGAGIAYVSAKAGFEVVLKDVTLEAAQK
GKAYSEKIEAKALSRGKTTQEKSQALLARITPSADPADFAGVDFVIEAVFENVELKHKVF
QEIQDVVEPDALLGSNTSTLPITILAEGVKRQEDFIGIHFFSPVDKMPLVEIIRGKNTSD
KALAKVFDYTLAIKKTPIVVNDSRGFFTSRVIGTLTQEALLALQEGVEPVTIEQAGLQAG
YPVGPLQLLDELTLTLPLKIAKETKAGVEASGGSVSQQENELIAILEELIEKHGRKGRSS
GAGFYDYDAEGKRGLLWAGLREAFHSGTAEIPLKDLQERYLFAEALETVKCFDEGVLTSV
PDANIGSIFGIGFPAWTGGVSQYIDGYPGGVAGFVERAKELAAAYGERFTPPASLLARV
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactacgcaaacaccatccgctgggaacaggacgccgacggcgtcgtcacgctc
gtgctcgacgacccgaaccaaagcgcgaacacgatgaaccaggacttcggcaagtcgctc
gccgcgacggtcgaacgtttggagtccgaggtcgagaagatccccggcgtcgtgatcacc
tccgcgaagaaaaccttcttcgcgggcggcgacctcaacgacctgatcaagttgcagccc
gaggacgcggcgcggttcaccgacgagctgaacacgctcaaggggtacttgcgccggttg
gagaaattgggcaagcccgtggtcgccgcgatcaacggcgcggcgctcggcggcggtctc
gagatcgccctcgccacccatcgtcgcatcgtcgccgacgtgaagggcgtccagctgggc
ttgccggaagtgcagctgggcctgctccccggcggcggcggcgtcacccgcacggtccgc
ctgctcggcatccagaacgccctcatgaacgtgctgttgcagggtccgaggctgaacccg
tccaaggcgaaggacctcggcctcgtgcatgagctcgtcggctcggtggacgagctggtc
ccggccgcgaaggcctggatcaaagccaaccccgaaggcggcgtgcagccctgggaccaa
cagggttacaagattcccggcggcagcccctccaccccgtcgttcgcccagttcgcgccg
gcgattccggcgaacctgcgcaagcagacccacggagccccgatgcccgcgccgcgcgcg
atcgtcgcggccgccatcgagggcgcccaggtcgacttcgacaacgcctcgctcatcgag
acccgttacatggtgtcgctggctgtcgggcaggtcgcgaagaacatgaccaaagcgttc
ttcttcgacctgcagcacatcaactcgggcggcagccggcccaaggacgagcccaagcac
acgccgaagaagatcggtgtgctcggcgccgggatgatgggcgcgggcatcgcgtacgtc
tcggccaaggccgggttcgaggtggtcctcaaagacgtgacccttgaagccgcgcaaaag
ggcaaggcgtactccgagaagatcgaagccaaggcgctctcccggggcaagaccacgcag
gagaagtcgcaagccctcctcgccaggatcacgccgagcgcggaccccgccgatttcgcg
ggcgtggacttcgtcattgaggcggtgttcgagaacgtcgagctcaagcacaaggtcttc
caagagattcaggacgtcgtcgagccggacgcgctgctcggctcgaacacttcgaccctg
ccgatcacgatcctcgccgagggggtgaagcgccaggaggacttcatcggcatccacttc
ttctcgccagtggacaagatgcccctcgtggagatcatccggggcaagaacacctcggac
aaggcgctcgcgaaggtcttcgactacaccctcgcgatcaagaagaccccgatcgtcgtc
aacgactcccggggcttcttcaccagccgcgtgatcggcaccctcacccaagaggcgctg
ctcgcgttgcaggagggcgtcgagccggtcactatcgagcaggcgggcctgcaggccggg
tatccggtcggcccgctgcaactcttggacgagctcactctgacgctgccgttgaagatc
gcgaaagagaccaaggcgggcgtcgaggcttctggcggctctgtgagccagcaggagaac
gagctcatcgccatcctggaggagctgatcgaaaagcacggccgcaaaggccgctcttcc
ggggcggggttctacgactacgacgccgaaggcaagcgcggcctgctgtgggccggtctg
cgtgaagccttccattccggcacggcggaaatcccgctcaaggatttgcaggagcgctac
cttttcgcggaagcgcttgagacggtcaaatgctttgacgaaggcgtgctcacctcggtg
ccggacgcgaacatcggctcgattttcggcatcggcttcccggcctggactggcggcgtg
tcgcagtacatcgacggatatcccggcggcgtcgctggcttcgtcgagcgcgccaaagag
ctcgcggccgcatacggggagcgtttcacgcctcccgcttcgctgctcgccagggtgtaa

DBGET integrated database retrieval system