KEGG   Segniliparus rotundus: Srot_2556Help
Entry
Srot_2556         CDS       T01238                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
srt  Segniliparus rotundus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Srot_2556
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Srot_2556
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Srot_2556
Enzymes [BR:srt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Srot_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2628194..2629759)
Genome map
AA seq 521 aa AA seqDB search
MGALGAAVLLGTGRLSARSSSAAGSDLFALGVASGDPLPDGVVLWTRLAPAPLAGDGFGG
MGAAPVTVQWQVASDEKFAHIVREGSVTATRELAHSAHPEVHGLEPDRVYYYRFKAGREL
SPVGRTRTAPAPGAHRDQVRFAFASCQRWDQGYYTAYDHMAEEDLDLVAHLGDYIYEYPF
TSEDNLRGEQVPDVFSARPTGLPRYRTQYALSKLDEPLRRAHASFPWVVVFDDHEVENDW
AGWHSGSEYHTPRAQFLAQRAAAFQARYEHQPLRVSARPHGASTQDYRRLGYGRLADFFA
LDTRQYRDPQPCSGVFGSDCPERTAPNRVMMGDRERAWLLDGLASSRAVWKVALNQVQIM
QTRLRLPKSADAATGERGIGYNVDCWDGYPAERAKLLGGAARRGIENLVVVTGDTHKNYA
GDLKPDFDDPASPVVAAEFVGTSISSGGDGKDVREQEAQMKADNPHLKFFNDQRGYVTCE
LTPERCRTDYRVLDYVQRPGSPIATLRSFVVESGRPGILDA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgcgctcggggccgccgtgctcctcggcacgggacggctgagcgcccggtcttcc
tcggctgcgggctcggacctgttcgcgctcggcgtcgcctccggcgatccgctccccgac
ggcgtggtgctctggacgcgcctcgcccccgcccccctcgccggggacgggttcggcggc
atgggcgcggccccggtcaccgtccaatggcaagtcgcctcggacgagaagttcgcccat
atcgtgcgcgaaggatcggtgacggccactcgcgagctcgcccattcggcgcacccggag
gtccacggactcgaacccgaccgggtctactactaccggttcaaagcggggcgggagctc
tcgccggtcggccggacccgcaccgcccccgcgcccggggcgcacagggatcaggtccga
ttcgcctttgcttcctgccagcgctgggaccagggctattacaccgcatacgaccatatg
gcggaggaagacctcgaccttgtcgcccacctcggcgactacatctacgagtatccgttc
accagtgaggacaacctccggggggagcaagtccccgacgtgttcagcgcccgcccgacc
ggcttgccccgctatcggacccagtacgccctgtccaagctcgacgaaccgctcaggcgc
gcgcacgcgtcgttcccctgggtggtcgtgttcgacgaccacgaggtggagaacgactgg
gcgggctggcattccggctctgagtaccacaccccccgcgcgcagttcttggcccagcgc
gccgccgccttccaggcgcgctacgagcaccagccgctccgcgtctcggcgcggcctcac
ggcgccagcacacaggactaccgcaggctcggctacgggaggctcgctgatttcttcgcc
ctcgacacacggcaataccgcgacccccagccgtgctccggcgtcttcggctccgactgc
ccggagcggaccgcgccgaaccgggtgatgatgggggaccgggagcgggcctggctgctc
gacgggctcgcgtcgagcagggcggtctggaaggtcgcgctcaaccaggtccagatcatg
cagacgcggctgcggctgcccaaaagcgccgacgccgctacaggcgagcgggggatcggc
tacaacgtggactgctgggacggctatcccgccgagcgggcgaaattgctcggcggcgcg
gcgcggcgagggatcgagaacttggtggtggtcaccggcgacacgcacaagaactacgcc
ggcgacctcaagcccgacttcgacgatccggcctcaccggtcgtcgccgccgagtttgtg
ggcacctcgatctcttcgggcggggacggcaaggacgtgcgcgagcaggaggcgcagatg
aaggcggacaatccgcatttgaagttcttcaacgaccagcgcggctatgtgacctgcgag
ctcacccccgaacggtgccgaaccgactaccgcgtgctggattacgtgcagcgaccgggg
tctccgatcgccacgctgcgcagtttcgtggtcgagtcgggccgcccggggattctcgac
gcctga

DBGET integrated database retrieval system