KEGG   Segniliparus rotundus: Srot_2637Help
Entry
Srot_2637         CDS       T01238                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
srt  Segniliparus rotundus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Srot_2637
Enzymes [BR:srt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Srot_2637
Transfer RNA biogenesis [BR:srt03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Srot_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2711463..2712197
Genome map
AA seq 244 aa AA seqDB search
MTSDAEFAAQLARDTGQILLGVQRSALLEGHDLGDAGDLLAQEFIARVLGVRKPLDAVLS
EEARDSAARLKARRVWIIDPLDGTSEFRRRGQDWAVHIALVEHGEPTAAAVSLPPRGKVF
QSDTVPKATGLLTGRLIASRGRTPFEALLVAKRLHLQLVQANSAGVKAMAVVEGEADAYV
HAGGQHQWDSAAPVGVALAAGLWCSRLSGAPLRYNGPDTYLPDLLICRMELKDEILSVLH
AQRN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcgatgcggagttcgcggcgcagcttgcccgcgacacaggccagatcctcctc
ggagtccaacgctcggccctgctcgaggggcacgacctcggcgacgcgggcgatctgctc
gcccaagagttcatcgcccgtgtgctgggcgtgcgcaagccgttggacgcggtcctgtcc
gaagaggccagggacagcgccgcccggctgaaagcgcgccgcgtgtggatcatcgacccc
ttggacgggaccagcgagttccgccgccgaggacaggattgggccgtgcacatcgcgttg
gtggagcacggcgagcccacggcggccgccgtgtcgttgccgccgcgcgggaaagttttc
caatccgacacagtgccgaaggcgacaggtttgctcacggggcggctcatcgcgagccgg
ggccgcacgccgttcgaggcgctgctcgtcgcgaaacggttgcacttgcaactcgtgcag
gcgaactcggcaggcgtgaaggcgatggccgtggtcgaaggcgaagccgacgcgtatgtc
cacgctggcggccagcaccaatgggactccgccgcccctgtgggggtggcgctcgccgcc
gggctctggtgttcgcgcctctccggcgcgccgttgcgctacaacgggccggacacctac
ctgccggacctgttgatctgccgcatggagctcaaagacgagatcctctcggtgttgcac
gcgcagcgcaactga

DBGET integrated database retrieval system