KEGG   Segniliparus rotundus: Srot_2671Help
Entry
Srot_2671         CDS       T01238                                 

Definition
F420 biosynthesis protein FbiB
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
srt  Segniliparus rotundus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Srot_2671
Enzymes [BR:srt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Srot_2671
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Srot_2671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2741326..2742663
Genome map
AA seq 445 aa AA seqDB search
MTTDHAAPGLSIFPVAGLPEFAAGDDVAAAIVDAVALRDGDVLVVTSKIISKAEGKIVPA
PEDPQERDALRRELVLQEARRVIAQRNRTLITENRLGIVAAASGVDNSNLPRNELALLPE
NPDSSAQRLRERVRELAGARIAVIITDTMGRAWRIGQTDAAIGTAGLTVLHRYGGTFDAH
GNELHVTEVAIADELAAAADLVKGKLGGVPVAVVRGLQPQDDGSTAQDLLRPVEEDLFSL
GVDEAVSQGRREAVPARRSVRRFSPEPVEPEEVRAAIGDALTAPAPHHTHPVRFVWLRDK
VVRERLLARMRAAWRADLESDLFTPEQVERRLAKGDILFDAPEVVVPFLVPEGAHTYRDE
RRNACERTMFLVAGGAAVQGLLVALAARDLGSCWIGSTIFSADIVREELGLDASWSPLGA
VAIGRPAQPPEPRPPWDMEPYLLER
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagaccacgccgcgccgggactgtccattttccctgtcgccgggttgccggaa
ttcgccgccggcgacgacgtcgccgcggccattgtggacgcggtcgcgctgcgggacggc
gacgtgctcgtcgtgacgtcgaaaatcatctccaaagcggaggggaaaatcgtcccggcc
ccggaagacccgcaggagcgcgacgcgcttcgccgggagctcgtcctccaagaagcccgg
cgcgtgatcgcgcagcgcaaccgcaccctcatcacggagaaccggctcgggatcgtggca
gccgcctcgggcgtggacaactcgaacttgccgcgcaacgagctggccctgctgcccgaa
aaccccgacagcagcgctcagcggctccgcgagcgggtgcgagagctcgctggggcgcgg
atcgcggtcatcatcaccgacacgatgggcagggcgtggcggatcgggcagaccgacgcg
gcaatcgggacggccgggctcacggtcctgcaccggtacggcgggacgttcgacgcgcac
ggcaacgagctgcacgtcaccgaagtcgccatcgccgacgagctcgccgccgccgccgac
ctcgtcaaaggcaaactcggcggggtgcctgtcgccgtggtccggggcttgcaaccgcaa
gacgacggctccacggcgcaagatttgctccgcccagtcgaagaggacctgttcagtctt
ggcgtggatgaggcagtgtcgcaggggcggcgggaggcagtgcccgcgcggcgctccgtg
cggcgcttctcgcccgaaccggtggaaccggaagaggtccgcgcggcaatcggggacgcg
ctcaccgcccccgccccgcaccacacgcatccggtgcggttcgtgtggctgcgggacaag
gtggtccgagagcggcttctggcccggatgcgggcggcctggcgggctgatctggaatcg
gaccttttcacgcccgaacaggtcgaacgacggctcgcgaagggggacatcctctttgac
gccccggaagtcgtcgtgcccttcctcgtccccgagggcgcgcacacgtaccgcgacgag
cggcgcaatgcgtgcgagcgcacgatgttcctggtcgcgggcggcgcggcggtgcagggc
cttctcgtcgcgctcgccgcgcgggatctcggcagctgctggatcggatcgaccattttc
agcgccgacattgtgcgcgaggaactgggcctcgacgcgagctggtcccccctcggcgcg
gtggccattggccggcctgcccagcccccggagccgaggccgccgtgggacatggagccg
tatctgctggaacgctaa

DBGET integrated database retrieval system