KEGG   Segniliparus rotundus: Srot_2765Help
Entry
Srot_2765         CDS       T01238                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
srt  Segniliparus rotundus
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Srot_2765
  Lipid metabolism
   00561 Glycerolipid metabolism
    Srot_2765
   00600 Sphingolipid metabolism
    Srot_2765
Enzymes [BR:srt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Srot_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2850741..2852123
Genome map
AA seq 460 aa AA seqDB search
MRRLLCALSMVAAVASCANPTHVTVAAPQGILPPMGWNSWNSGIDINDQSIRGTIDAMVS
SGMRDAGYSYVNLDAGWAAPERSSTGELAADPQRFPFGLKPLADYAHERGLRFGLYSSPF
NQTCGQSVGAASLGHETQDAATFAAWGIDFLKYDWCGPKASHDEQTRIFGAMGSALRKSG
RRIVYSINPNSADDPAAGARFDWSGVADMVRVCGDLVPLWRNALPPLGSPDPFAARVFNA
LPDQLADAVNSAARPAYRNDPDMLVVGVTWSEFFLNHRELVLRSARNRLLTADQRVQLEP
LLSMSAQTAQWMAAAQPGLTEDEQRSHFSLWAMLGAPLLAGNDLRSMSAATSSMLTNREV
IAVDQDPLLATAHQVGGDGRIFAKPLADSSVAVALFNSSNAVADIATTAHAVGLPPASCY
TLRDLWTGQSVGTAGGIVARSVAPHAVQLLRAVQAARCSP
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccgactgctctgcgcgctgagcatggtggccgctgttgccagctgcgcgaatccc
actcatgtcacggttgccgcgccccaggggatccttcccccgatggggtggaactcatgg
aactcgggaatcgacatcaacgaccagtccatccgggggaccatcgacgcgatggtctcc
tccggcatgcgcgacgccggatactcctatgtcaacctggacgccggatgggcagcgccc
gaacgcagttccaccggtgaactggccgccgacccgcaacgctttccgttcggcctcaag
ccgttggccgactacgcgcacgagagggggctgcggttcggcttgtactcgagcccgttc
aatcagacctgcgggcaaagcgtgggcgctgcgagcctcggccacgaaacccaagacgcc
gcgacgtttgccgcgtggggaatcgacttcctcaagtacgattggtgcggcccaaaagcc
agccacgacgagcaaacgcggattttcggcgcgatgggttcggcactgcgcaaaagcggt
cggcggatcgtctacagcatcaaccccaacagtgccgacgatccagcagcaggcgcccgc
ttcgactggtccggcgtcgccgacatggtgcgcgtttgcggcgacctggtcccgttgtgg
cgcaatgccctgccgccgctgggctcgccagacccctttgccgcacgcgtcttcaacgct
ctgcccgaccagctcgcggacgccgtcaacagcgccgcccggcccgcgtatcgcaacgac
ccggacatgctggtggtcggtgtgacatggagcgagttcttcctcaaccaccgagagctc
gtgctccgcagcgcccggaacaggctcctgacagccgatcaacgcgtccagctcgaacct
cttttatccatgtcggcgcagaccgcgcaatggatggccgccgcgcaacccggcttgacc
gaggacgagcagcgcagccatttctcgctgtgggcgatgctcggcgcgccgctgctcgcc
ggcaacgacctgcggtcgatgtcggcggccacatcgtcgatgctcaccaaccgcgaggtc
atcgccgtcgatcaggacccgctcctggcaacagcccatcaggttggcggcgatgggcga
atcttcgccaaaccgctcgcggattcctcggtggcggtcgcgctgttcaattcgtccaac
gcggtggccgatatcgcaaccacagctcacgctgtcgggctgcccccggcgtcctgctac
accctgcgcgacctgtggaccggtcagagcgtcggcaccgccggcggcatcgtcgcgcga
tccgttgccccgcacgctgtccagctcctacgagccgtgcaagcggcgagatgctccccg
tga

DBGET integrated database retrieval system