KEGG   Segniliparus rotundus: Srot_2793Help
Entry
Srot_2793         CDS       T01238                                 

Definition
proline dehydrogenase
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
srt  Segniliparus rotundus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Srot_2793
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     Srot_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2889613..2890602)
Genome map
AA seq 329 aa AA seqDB search
MNKGSPLLAALRHPARPVLLAASKSQRLESLSQRFAFTRAVVSRFVAGYELDDALRVVAD
LLGSRFVSVDHLGENVRDRAQAEAAVQAHRDLLDGLGRVRDELAARGQPLPDGALEASIK
LSAFGQLLPDGQALALAGAQALCAKADEVGALVTVDMEDHTTTEATLSVVRALRSDFPWT
GAVLQSYLKRTEADCRDFAGPGSRIRLCKGAYQEPKSVAYQDKEQVDSSYKRCLAVLFEG
DGYPMVASHDPAMIAEATRLAAATSRVASSYEHQMLYGVRADEQARLAASRVRVRTYVPY
GGRWYGYFVRRLAERPANLGFFLRALAGR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagggatcgccgctgctcgcggcattgcggcacccagcgcgcccggtgctgctc
gccgcttcgaagagccagcgcctcgagtctctttcccaacgcttcgcgttcacccgcgcc
gtggtgtcgcgcttcgtcgccgggtacgagttggacgacgcgttgcgcgtcgtcgcggat
ctgttgggctcgcgcttcgtctcagtggatcacctgggggagaacgtccgcgaccgcgcg
caagccgaggccgctgtccaagcgcaccgcgatctgctggacggcctgggacgggtgcgc
gacgagctcgccgcgcgtgggcagcccctgcccgacggcgcgctcgaggcctccatcaag
ctttctgccttcgggcagctcttgccggacggccaggcgctcgcgctggcgggcgcgcag
gcgctgtgcgcgaaggccgacgaggtcggcgcgctggtcaccgtggacatggaggaccac
accaccaccgaagccacgctttctgtcgtgcgggcgttgcggtcggacttcccgtggacc
ggcgcggtgctgcaaagctatctcaagcgcaccgaggcggactgccgcgatttcgcgggc
ccaggttcgcggatccggctctgcaagggcgcctaccaggagccaaaatctgtcgcctac
caggacaaagaacaggtcgactcctcgtacaagcgctgccttgcggtgcttttcgagggc
gacggctacccgatggtggcctcgcacgaccccgcgatgatcgccgaggcgaccagactt
gccgcggcgaccagtcgcgtcgcgtcgagctatgagcaccagatgctgtacggggtgcgg
gcggacgagcaggcgcgcttggccgcctcgcgcgtgcgggtgcgcacctatgtgccctac
ggcgggcgatggtacggctactttgtgcgccgtctcgccgagcgccccgcgaacctgggg
tttttccttcgggcactggcaggcaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system