KEGG   Segniliparus rotundus: Srot_2942Help
Entry
Srot_2942         CDS       T01238                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
srt  Segniliparus rotundus
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:srt00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Srot_2942
Enzymes [BR:srt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Srot_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3036742..3038445
Genome map
AA seq 567 aa AA seqDB search
MPENRDFDVLVIGSGFGGSVTALRLAEKGYSVAVLEAGRRFADNELPKTNWNVRKFLWAP
KLGAFGVQRIHFLPDCTVLAGAGVGGGSLNYANTLYVPKDAFFNDPQWAHITDWKSELAP
HYEQAKKMLGVTRNPKPTNSDRHMRAVAEDMGVGDTFVPTPVGVFFDKPGVRVPDPFFGG
AGPERTGCTECGSCMTGCRVGAKNTLVKNYLALAEQAGAKVFPLTEVREVRQRQDGTWEA
RARHPSAWFGTATSVFTARNVVVAAGTWGTQQLLHRMKAEGVLPKLSDRLGELTRSNSES
ILGAARRAVAEDDNLSQGVAITSSFHPEENTHIEPVRYGKGANAMFALGTLLTHGDGPGP
RWLTFLRQAARSPGALLRTLNLRRMSERTIVVLVMQTLDNSLTTFVKKGLFGTRLSSKQG
HGLPNPTWIPVGNETARRVADKIGGDAFGCWPDVFNLTMTAHFIGGAAISDTPQQGVIDP
YHRVWGYPTLFVTDGAAVSANLGVNPSLSITAQAERAASLWPNKGEEDPRPAQGQLYRRV
EPVAPKNPQVPAWAPAALGWPTVRQEA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaaaccgtgatttcgacgtgctcgtcatcggttctggattcggaggcagcgtc
accgcgctgcggctcgcggagaagggctacagcgtggccgttctcgaagcgggcagacgg
ttcgccgacaatgagctgccgaagacgaactggaacgtccgcaagttcctctgggccccc
aaactcggcgcgttcggcgtgcaacgcatccacttcctgcccgactgcacggtgctcgcc
ggggccggggtgggcggcggctcgttgaactacgccaacacgctgtacgtcccgaaggac
gcgttcttcaacgacccgcagtgggcgcacatcaccgactggaagtccgagctggccccg
cattacgagcaggcgaagaagatgctcggcgtgacgcgcaacccaaagccgacgaactcg
gaccgccacatgcgggccgtggccgaggacatgggggtcggcgacaccttcgtccccacc
ccggtgggggtcttcttcgacaagccgggcgtccgcgtgcccgatcccttcttcggcggc
gcgggaccggagcgcaccggctgcaccgagtgcggctcgtgcatgaccggctgccgtgtc
ggcgcgaagaacaccctggtgaaaaactacctcgccctcgccgagcaggccggcgcgaaa
gtcttcccgctcaccgaggtccgcgaagtgcgccaaagacaggacgggacgtgggaggcg
cgcgcccggcatcctagcgcgtggttcggcacagccacgagtgtgttcaccgcgcgcaac
gtcgtggtcgcggctggcacctggggcacccagcagctcctgcaccggatgaaggccgag
ggcgtgctgccgaagctgtcggaccgtctcggcgagctcacccgcagcaactcggagtcc
atcctgggcgcggcgcggcgcgcggtggccgaggacgacaacctcagccagggcgtggcg
atcacatcctccttccacccggaggagaacacgcacatcgaaccggtccgctacgggaag
ggcgcgaacgccatgttcgcgctcggcaccctgctcacccacggcgacgggcccggcccg
cgctggctgacgttcctgcggcaagcggcccgcagccccggcgcgctgctgcgcacgctg
aacctgcgccggatgagcgaacggacgattgtcgtgctcgtcatgcagaccctcgacaac
tcgctcacgacgttcgtcaaaaagggcctcttcggcacgcggctgtcctccaagcaaggc
cacggcctgcccaacccgacctggattcccgtcggcaacgagaccgcgcggcgggtcgcg
gacaagatcggcggcgacgcgttcgggtgctggccggacgtcttcaacctgaccatgacg
gcgcacttcatcggcggggccgcgatctcggacaccccgcagcagggcgtgatcgacccc
tatcaccgcgtctggggctatccgacgctgttcgtgacggacggagccgccgtctcggcg
aacctcggcgtgaacccgtccttgtcgatcaccgcccaagccgagcgcgcggcctcgctg
tggccgaacaaaggcgaagaagacccccgccccgcccagggccagctctaccggcgcgtc
gagccggtggccccgaagaacccgcaagtgcccgcctgggccccggcggcgttgggatgg
ccgaccgtgcgccaggaggcgtaa

DBGET integrated database retrieval system