KEGG   Segniliparus rotundus: Srot_2988Help
Entry
Srot_2988         CDS       T01238                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
srt  Segniliparus rotundus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:srt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3079633..3081150
Genome map
AA seq 505 aa AA seqDB search
MPDFVAAVDQGTTSTRCMLFDREGKEQGRHQLEHTQILPRPGWVEHNPVEIWERFRTVTQ
TLLDAKGLRASDLAAVGITNQRETTVVWNKKTGRPYHNAIVWQDTRTDRLAAAVERSGKG
DVVRQKAGIPPATYFSGGKLAWLLENVPGLRQDAERGEALFGTIDTWLLWRLTGGFEGGA
HLTDVTNASRTMLMDIDTLDWDEELLGIWGVPRAMLPEIRPSSDPEFFGHTNNRGPFLGE
VPVAGMLGDQQAAMVGQLCLEPGEAKNTYGTGNFLLLNTGESPVRSQNGLLTTVCYQFGR
DTARYALEGSIAVTGSAVQWLRDQLGVISRAEESEALARSVKDNGGVYFVPAFSGLFAPH
WRSDARGAIVGLSRFNTNAHIARAALEAICYQSKDVVDAMERDSGVRLEVLKADGGITAN
ELCMQIQADVLGVDVVRPVVAETTALGAAYAAGLAVGFWASTDDLRQNWQEGKRWSPATT
EEEREAGHARWRKAVERTLGWVDVD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacttcgtcgccgccgtcgaccaaggcaccacctcgacgcgatgcatgctcttc
gaccgggaaggcaaggaacagggtcgccaccagctcgaacacacgcagatcctgccgcga
ccaggctgggtggagcacaaccccgtggaaatctgggaacggttccgcacggtcacccag
accttgctggacgccaaggggctgcgcgcgtcggacctggccgccgtggggatcaccaac
cagcgtgagacgacggtggtgtggaacaagaaaaccgggcggccctatcacaacgcgatt
gtctggcaggacacccgcaccgaccggctggcagccgctgtggagcgctccggcaaaggc
gatgtggtgcggcagaaagcgggcataccgcccgcgacgtacttctcgggcggcaaactc
gcctggctgctggaaaacgtccccggtctgcgccaagacgccgaacgcggcgaagctctg
ttcggcacgatcgacacctggctgctgtggcggctcaccgggggcttcgagggcggcgcg
cacctgaccgacgtgacgaacgcgtcgcggaccatgctgatggacatcgacacgctcgac
tgggacgaggagctgctcggaatatggggcgtgccgagggccatgctgcccgagatccgc
ccctcctcggacccggagtttttcggccacaccaacaaccgggggccgtttctcggcgaa
gtgccggtcgccgggatgctcggcgaccaacaagccgcgatggtcgggcagctgtgcctg
gagcccggcgaggcgaaaaacacgtacggcaccggcaacttcctcctgctcaacaccggc
gaatcgcctgtgcgctcgcagaacggtctgctcaccacggtctgctaccagttcggccgc
gacacagcgcgctacgccctcgaaggctccatcgcggtgaccggctccgcggtgcaatgg
ctgcgcgaccagctcggcgtcatcagcagagcagaggaaagcgaggcgctggcccggtcg
gtcaaagacaacggcggcgtctacttcgtgcccgcgttctccgggctcttcgcgccgcac
tggcgctcggacgcgcgcggggccatcgtcgggctctcccggttcaacaccaacgcccac
atcgccagggccgccctcgaagcgatctgctatcagagcaaggacgtggtggacgccatg
gaacgcgactccggcgtgcgcctggaagtgctcaaagccgacggcgggatcacggcgaac
gaactgtgcatgcaaatccaggccgatgtgctcggcgtggacgtggtgcgcccggtggtc
gccgaaaccaccgcgctcggcgcggcgtacgcggccgggctggccgtcggcttctgggcc
tcgacagacgacctgcggcagaactggcaggaagggaaacggtggagccccgccaccact
gaagaggagcgggaagcagggcacgcccgatggcgcaaagccgtcgagcgcaccttgggc
tgggtggacgtcgactga

DBGET integrated database retrieval system