KEGG   Salinibacter ruber DSM 13855: SRU_0238Help
Entry
SRU_0238          CDS       T00312                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRU_0238
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SRU_0238
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SRU_0238
Enzymes [BR:sru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SRU_0238
Exosome [BR:sru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRU_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
317533..319095
Genome map
AA seq 520 aa AA seqDB search
MWGLFLVNFAGLPECKLVRQHANFRYMPVRSSTFHLLPASRLVSAVRPFFAALVLCLLLA
GPAPAQTVPDAPAPEEAPNVILMIPDGFGPASVTMARDYLRWRDGQKELPYDSLQVGSIR
TYASDSYITDSAAGGTALATGTKTYNGAVAVDTSRQAVATLLEGAERRGMSTGLVVTSRL
THATPAVFSSHVPDRGQENRIARQQLNKDIEVMLGGGRRHFLPQSAEGSAREDDLDLLQA
AQDRGYEVVQTASELSRAGEGQTQENRLLGLFSPGHMAYEIDRDHTQQPSLAAMTETAID
RLSGNGEGYFLMVEGSRIDHAGHGNDAASHLRDILAFNRAAKSALEAAQEDDNTLVVIVS
DHETGGLTLGRNRDGEGIYSWRPETLAAVEASSGAIADSIRSIRSTGASEAAKRKRIAGT
LTRLTGVQDVPTEIVSNLMAVEGPYAVGNAVSPLVNRQALVGWTSHAHTAVDVNLYAYGP
GANAFVGHHDNTTIAQKLANLMDVDLESLTGTLRAGRDAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgtggggcttgtttctggtaaattttgcgggccttccagaatgcaaactcgttcgtcaa
cacgccaattttcgatacatgccggtgcgctcatccacgttccacttgctccctgcatcc
cgcctggtctccgcagtccgcccgttcttcgctgcccttgtcctttgcctgcttttggcc
ggtccggccccggcgcagaccgttccggatgcccctgcgcccgaggaggccccgaacgtt
atcctcatgatccctgatggcttcgggcccgccagcgtgaccatggcccgggactacctc
cggtggcgcgacggccagaaggagcttccctacgatagcctccaggtagggagcattcgc
acctacgcctctgacagctacatcaccgactcggcggccgggggcacggccctcgctacg
ggcacaaaaacctacaacggggcggttgcggtcgatacctcccgccaggcggtggcgacg
ctgctggagggggccgagcggcgcggcatgtccaccgggcttgtcgtgacgagtcgcctg
acccacgccaccccggcggtcttctcgtcccatgtgccggaccgcggtcaggagaaccgc
atcgctcgccagcagctcaacaaggacatcgaggtcatgctgggtgggggccggcgccac
ttcctgcctcagtcggctgagggaagcgcccgggaggacgacctcgaccttctgcaggcg
gcccaggaccgggggtacgaggtggtccagacggcgagcgaattgagccgagccggcgag
ggccagacgcaggagaatcgccttctgggcctgttcagcccagggcacatggcctacgag
atcgaccgcgaccacacccagcagccaagcctcgcggcgatgacggaaaccgccatcgac
cgcctgtccggcaacggggagggatacttcctgatggtcgagggcagccgcatcgaccat
gccggccacggcaacgacgccgcttctcacctccgagacatcctggccttcaaccgggcg
gcaaagagcgcgctggaggctgcccaggaggacgacaacacgctggtggtcatcgtgtcg
gaccacgagaccggcggtctcacgctgggccgaaaccgggacggagaggggatctactcc
tggcgcccggagacgctggccgccgtggaggcctccagcggcgccattgccgacagcatc
cgatcgatccgctccaccggagcaagcgaggcggcaaagcggaagcgcattgccggcacg
ttgacccgcctgaccggcgttcaagacgtgccgacggagatcgtctccaacctgatggcg
gtcgaggggccctacgccgtcggaaacgccgtctctccacttgtcaaccggcaggccctg
gtcgggtggacgagccacgcccacacggcagttgacgtgaacctctacgcctacgggccc
ggggcaaacgcgtttgtcggccaccacgacaacaccaccattgcccaaaagcttgcaaac
ctcatggatgtggatctggagtcgctcaccggcaccctgcgtgcggggcgggacgcccgg
tag

DBGET integrated database retrieval system