KEGG   Salinibacter ruber DSM 13855: SRU_0308Help
Entry
SRU_0308          CDS       T00312                                 

Gene name
nosZ
Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sru00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
414287..416176
Genome map
AA seq 629 aa AA seqDB search
MFRIFLSKIRPPIPMRSLTYLFLLVLPLGLLGCGGSSASDDGAPASYVPPGEKDDYYLFY
SGGHSGQVFVAGLPSLREIQEIPVFTPSPGHGYGFSKKSKKMMGEYRWGDVHHPGLSKTD
GTYDGRWLFVNDNANNRVARISLRDFKTKQILGPIPNSMGNHGSSFVTPNTEYLLVATRF
SVPLPKGTHAPVETYEENFNGIVSGVDIDPETGEMEVGWQVKTPPFNWDLGSTGKGPSDG
WAFWTSYNTEMAHDSLEINASQRDRDYAAFVNWERAEEVVENNEGLNRRNGVPLIDPAEH
EGVMYFVPVSKSPHGIDASPSGRWIAASGKLQPTTTVFDFKQFKTAIENEDFQGEFRGVP
VVNYDAVVEGEVPVGQGPLHTQFDGEGNAYTSLFIESSVTKWKLPPWDKETTEDMSKAVT
DKISVHYNIGHLVIPGSDTKEPYGNWLVAMNKLQKGRGLNVGPEKPETSQLIDISGEEME
MIEEDYTRPEPHFAQAVPADVINPIEVYKKENNDHPDARWDPENTGVERTGPDEVTVHMI
AKRSQYYPDKVEVQQGDKVTFHLTNIEQVSDMIHGFGIAQYNMNGVVPPGDTQTFTITAD
EAGVYPFYCTNFCSALHQEMQGYLEVKPR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcgtatctttttgtctaaaatacgacccccgatacctatgcgatcactcacatac
ctcttcctgctcgtcctcccgctgggcctgttgggctgtggcgggtcgtcggcttctgac
gacggcgcgcccgcctcgtacgtcccccccggcgagaaggacgactactacctcttttac
tccggcggccactccggccaggtcttcgtggccggcctgccgtcccttcgcgagattcaa
gagatccccgtctttaccccctcccccggccacggctacggcttcagcaagaagtcgaag
aagatgatgggcgagtaccgatggggcgacgtgcaccaccccggcctctcgaagacggac
ggcacgtacgacggccgctggctcttcgtgaacgacaacgccaacaaccgggtcgcgcgc
atcagcctgcgggactttaagacgaaacagatcctcggccccatccccaactcgatgggg
aaccacggctcctccttcgtcacgccgaacaccgagtacctgctcgtcgccacccgcttc
tcggtgccgctgccgaagggcacacacgcccccgttgagacctacgaggagaatttcaac
ggcatcgtcagtggcgtggacatcgacccggagacgggcgaaatggaggtggggtggcag
gtcaaaacgcccccgttcaactgggacctcggctccaccggcaaggggccgagtgacggc
tgggcgttttggacctcctacaacaccgagatggcgcacgactccctggagatcaacgcc
agccagcgcgaccgcgactacgccgcgttcgtgaactgggagcgcgccgaggaggtcgtc
gagaacaacgagggcctgaaccgtcgcaacggggtgccgctcatcgatccggccgaacac
gagggcgtcatgtacttcgtgccggtcagcaagtccccccacggcatcgacgcctcgccg
tcgggccgctggatcgcggcctccggcaagctgcaaccgaccaccacggtgttcgacttc
aagcagttcaagaccgcgatcgaaaacgaagactttcagggtgaattccgcggtgtaccc
gttgtgaactacgacgccgtcgtggaaggcgaggtgccggtcggccagggcccgctccac
acgcagttcgacggcgagggcaacgcctacacgtcgctcttcatcgagtcgagcgtgacg
aagtggaaactgccgccctgggacaaagagaccacggaggacatgagcaaggccgtgacg
gacaagatcagtgttcactacaacatcggccacctcgtcatcccgggcagtgacacgaag
gagccgtacgggaactggctcgtggcgatgaacaagctccagaagggccgcgggcttaac
gtcggccccgagaagccggagacgagccagctcatcgacatctcgggggaggagatggag
atgatcgaggaagactacacccggcccgagccgcactttgcgcaggccgtgccggcggac
gtgatcaaccccatcgaggtctacaagaaggagaacaacgaccaccccgacgcccgctgg
gacccggagaacaccggcgtggagcgcaccggcccagacgaggtcaccgtccacatgatc
gccaagcgcagccagtactacccggacaaggtcgaggtgcaacagggcgacaaggtcacg
ttccacctgacgaacatcgagcaggtgtcggacatgatccacggcttcggcatcgcccag
tacaacatgaacggagtggtgccccccggtgacacgcagacgttcaccatcacggccgac
gaggcaggggtgtatcccttctactgcaccaacttctgctcggcgctccatcaggagatg
caggggtacctggaggtgaagccgcggtag

DBGET integrated database retrieval system