KEGG   Salinibacter ruber DSM 13855: SRU_0336Help
Entry
SRU_0336          CDS       T00312                                 

Gene name
cheB
Definition
protein-glutamate methylesterase CheB
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SRU_0336 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SRU_0336 (cheB)
Enzymes [BR:sru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     SRU_0336 (cheB)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SRU_0336 (cheB)
Two-component system [BR:sru02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SRU_0336 (cheB)
Bacterial motility proteins [BR:sru02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SRU_0336 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
450312..454091
Genome map
AA seq 1259 aa AA seqDB search
MKNKFVDTTLTVRCRFGKHESVRATVGGFVHVGRVRPGPGSTFPECPRRRAHTSLFLQIA
TGCVADCMSSSSKEAIQASPVGPGSDETSEQSVPVVAIGASAGGVGALRAFFEALPSDGG
MAFVVVLHLSPDHESSLAEILQHDTDMPVQTATDDCGLRPDHVYVIPPRHEMWVEGTQLR
LSAHSDRHRPHTIDALFDSLAEEHGAQAVGIVLSGTGTDGTLGLRAIKTHGGIAMVQEPA
DAGHEEMPRNALEAGVIDLVRPASALAEQLVAYHRNAHAIQLPESEEALPSGEQTTLQKI
FAALRTHTGHDFSHYKRSTVLRRLERRLQVTDTETLEAYLQVLEDRPGETRALYKELLIS
VTRFFRTPEAFDELADTVLPRLFEDTAADDEVRVWVPGCATGEEAYSVAMLLHEHARARE
APPELQVFATDVDTEGLDTARRGTYPVSIEADVPDERLNRFFYREEDRYHVTSSLRNTVV
FAEHNLIEDPPFSKLDLICCRNLLIYLDQTMQEYVFRLFQYALDPGGFLFLGPSEAVGPA
QSSFSVVDDTRSILKAKPPAPDEDRPMPLFAPSRAASEPPSSSPSPVSAPTDVAATHRRL
LMDQVASLLVDENREIVHLTGRAGRFLEHNPGTPTHNLLEKVHPLLRLELRGALYQAFQK
GEATERTVPFPDAGDGPEHVRVRVQPLDDAEGGQRLAQVCFEEADAPGRGVDEDGEATVS
SKEPTERERDLESELQDVKEQLQITSEEHETVTEEMETANEELMSMNEELQAKNEELQTS
KEQLQSVNEELTTTNQQLNAKVEALDQANNDLQNLMEATQVGTLFLDRDLEIRRYTSPMT
DIFGLRSVDEGRPITDFIPKIAYDALVADAERVLEEQASIEREVEGPGRMWYLMRLRPYR
TVSGEVEGVVMTFVDITAQKHAAETLRAERDLVSALIDTAGALIVVLGEDGSIVRFNTAC
ERLTGYDAAEAEGTDLRDLLVAPDDREAVTSRLDALADGTTDRADLEMRWAPAEGEPRLI
KGSFTALRHESGAVQHFIVTGTDMTRHRELEREVIEISDRERQRIGEALHDVISSGLTHV
VMRTDTLAHRLKEEGTAVTADDLEGISSEVKEAADQIRSLSHALIPRALRQDHLAAALAD
LADEEEDFSDVECVFVGEEGETRPEDETDAMNLYRIAHEAVANAREHADPSRIQLGLREE
GADLVLSIRDDGRGWEGDTPEDEGLGLHLMRYRANLIGATLRLTSDDGETVVECRLPLP
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaataaatttgtcgatacaacgctgacggtccgctgtcgattcgggaaacatgag
tcggtgcgggcgactgtcggcgggttcgttcacgtcgggcgtgtccgtccgggtcccggt
tcaacattcccagagtgtcctcgtaggagagcgcacacatcactctttcttcaaattgcg
acaggttgcgtcgcggattgcatgagctcctcttcgaaagaggccattcaggcatctcct
gtaggtccggggtcggacgagacgtcggagcagagcgtgccggtcgtggccattggggcg
tcggcggggggcgtgggggcgctccgtgcgttctttgaggcgttgccgagcgacgggggg
atggcattcgtcgtggtgttgcacctctcgcccgatcacgaaagcagcctcgccgagatt
ctccagcacgacaccgacatgccggtgcagacggcgacggacgactgtggtctgcggccg
gaccacgtctacgtcattccgccccggcacgagatgtgggtagaggggacccagcttcgc
ctgtcggctcattccgaccggcaccgtccccacaccatcgacgcgctgttcgactcgttg
gccgaggagcacggggcccaggccgtcggcatcgtgctgtcgggcaccggcacggacggc
acgctgggcctgcgggccatcaagacgcacgggggcattgccatggtgcaagagcccgcc
gacgcggggcacgaggagatgccgcgcaatgcgttggaggcaggggtgattgacctcgtg
cgcccggcctccgcgctcgcggagcagctggtggcctatcaccggaacgcccatgccatc
cagctgcccgagtccgaagaggcgctcccttccggcgagcagacgacgctccagaagatc
ttcgccgcgctgcggacccacaccgggcacgactttagccactacaagcggtcgaccgtg
ctgcggcggctcgaacggcggcttcaggtgaccgacaccgagacgctggaggcctacctc
caggtgcttgaggaccggccgggagagacgcgggccctctacaaggaactgctcatcagc
gtcacgcgctttttccggacgccagaggcattcgacgagttggcggacacggttctcccg
aggctgtttgaggacacggcggccgacgatgaggttcgggtgtgggtccccgggtgtgcc
acgggcgaggaggcgtactcggtggcgatgcttttgcacgagcatgcccgcgcgagggaa
gccccgccggagctgcaggtgtttgccaccgacgtggacaccgaagggctcgacacggcc
cggcggggcacgtacccggtgtctatcgaggccgacgtccccgacgagcgtctcaaccgt
ttcttctaccgggaggaggaccggtaccacgtcacgtcgtcgctccggaatacggttgtc
ttcgccgagcacaacctcatcgaggatccccccttttcgaagctcgacctgatctgctgc
cggaacctgcttatctacctggaccagacgatgcaggagtacgtgtttcggctgttccag
tacgcgctagacccgggaggatttctgttcctcgggccctcggaggccgtcggcccggcg
cagtcctcgttctcggtggtcgacgacacgcggagcatcctgaaggcgaaaccgcccgcg
cccgacgaggaccggccgatgccgctctttgccccatcgcgcgctgcgtcggagcccccc
tcgtcctccccgtctccggtgtcggcgccgacggacgtggctgccacgcatcggcgcctg
ctcatggatcaggtggcgagcctgctggtcgacgaaaaccgcgagatcgtgcacctgacg
gggcgggcgggacgctttctggagcacaatccgggcacccccacgcacaacctgctggaa
aaggtgcacccgctgctccgactcgaactgcgcggggcgctctaccaggcgttccagaag
ggggaggcgacggagcggaccgttccctttcccgacgcgggcgacgggcccgagcatgtg
cgggttcgggtgcagcccctcgacgacgccgaaggggggcagcgtctcgcacaggtctgt
tttgaagaggccgacgccccggggcggggcgtggacgaggatggcgaggcgaccgtgtcg
tcgaaggagccgacggagcgggagcgcgacctggaaagtgaacttcaggacgtcaaggag
cagctccagattacgagcgaggagcacgagaccgtcaccgaggagatggagacggccaac
gaggagctgatgtcgatgaacgaggagctccaggccaaaaacgaggagcttcagaccagc
aaggagcagctgcagtccgtcaacgaggagctgacgaccaccaaccagcagctcaacgcc
aaggtggaggcgctcgaccaggccaacaacgacctgcagaacctgatggaggcgacccag
gtgggcaccctgttcctggaccgggacctggagatccgccgctacacgtcgccgatgacc
gacatttttgggcttcggagcgtcgacgaggggcgtcccatcacggactttatccccaaa
attgcgtacgacgcgctggtggcggatgcggaacgtgtgcttgaggagcaggcctcaatc
gagcgtgaggtggagggccccggtcggatgtggtatctgatgcgtctccgcccgtaccgc
acggtgtcgggcgaggtggagggcgtggtgatgaccttcgtcgacatcaccgctcagaag
cacgccgccgagacgctgcgggcggagcgggatctcgtgtcggccctcatcgacaccgcc
ggggccctgatcgtggtgctcggcgaggacgggtccatcgtgcgcttcaacacggcctgc
gagcgcctcaccggctacgacgccgcggaggcggaggggacggacctgcgcgatctgctc
gtggcccccgacgaccgggaggcggtgaccagccgtctcgacgccctcgccgacgggacg
accgaccgggccgacctggagatgcggtgggcgccggcggagggcgagccgcgcctcatc
aaagggtcatttacggccctccggcacgaatcgggggctgtgcagcacttcatcgtgacg
ggcaccgacatgacccggcaccgcgagctggagcgcgaagtgatcgagatcagcgaccgg
gagcgccagcgcatcggagaggccctgcacgacgtcatcagctcggggctgacccacgtc
gtgatgcgcacggacaccctcgcccacaggctcaaagaggagggcacggcggtgacggcc
gacgacctggagggcatttcgtcggaggtaaaggaggcggccgaccagatccgctccctc
tcccacgccctcattccccgggccctccggcaggaccacctggccgcggccctcgcggac
ctggccgacgaggaagaagacttttcggacgttgagtgcgtgttcgtgggggaggaaggc
gagacgcgccctgaggatgagaccgacgcgatgaacctgtaccgcatcgcccacgaggcg
gtggccaatgcccgcgagcacgccgacccgagccgaattcagctcgggctgagggaggag
ggcgccgacctggtgctttccattcgggacgacgggcgcgggtgggagggagacaccccg
gaggacgaggggctcggcctgcacctgatgcgctaccgggccaacctcatcggggccacc
ctgcgtcttaccagcgacgacggggagacggtggtggagtgccgcctgccgcttccgtag

DBGET integrated database retrieval system