KEGG   Salinibacter ruber DSM 13855: SRU_0348Help
Entry
SRU_0348          CDS       T00312                                 

Gene name
pncB
Definition
nicotinate phosphoribosyltransferase
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sru00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(466337..467725)
Genome map
AA seq 462 aa AA seqDB search
MPFDDQLRPDTSALYTDLYQLTMLQAYWREDMDEPAVFDLFVRRLKDRHYLVACGLEQAL
EFLETLSFSEAALDYLATQDPFEPAFLDWLADFEFTGDVYAVPEGTPVFPDEPLVEVVAP
IGEAQLAETFLLNQITFQTTIASKASRIVEAAQLDGEDRIVADFGMRRTHGTDAAVKGAR
AAYVAGIDATSNVAAGQAYDLPVTGTMAHSYVEAHDSEVEAFRAFSALYPETILLVDTYD
TLDGVRKVIDLMNETGDEVQVRGIRLDSGDLAELARSSRTLLDEAGLADVMIFASGGLDE
HTIADLLDRGAPIDGFGVGTRMGTSADQPALDTAYKLSGYAGTPRMKLAPEKSNLPGRKQ
VVRQYEDGTAVRDVIATEDEQTNGAPLLERVMADGKRTEAGAPRPLSAIREHAAARLDEL
PSRLRAPTANPEDYDVVLSDALEKRVADTRDALAETMAAEAA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcgacgatcagctccgcccggacacgtccgcgctgtacacggacctctaccag
ctcaccatgctgcaggcctactggcgggaggacatggacgagccggcggtgttcgacctc
ttcgtgcgccgcctgaaagaccggcactacctggtggcctgtgggcttgagcaggcgctg
gaattcttggagacgctttcgttttcggaggcggcactcgactacctcgccacgcaggac
ccgttcgagcccgcattcctcgactggctggccgacttcgagtttaccggcgacgtgtac
gccgtgcccgagggcacgccggtcttccccgacgagccgctggtggaggttgtggccccc
atcggggaggcccagctcgcggagacgtttctcctgaatcagattacgttccagacgacg
attgcctcgaaggcgagccggatcgtcgaggccgcccagctcgatggagaggaccggatc
gtggccgacttcggcatgcgtcggacgcacggcaccgacgcggcggtgaagggcgcccgc
gcggcgtacgtcgcggggatcgacgccacctccaacgtggccgccggccaggcctacgac
ctgccggtcaccggcaccatggcccacagctacgtcgaggcgcacgactcggaagtggag
gccttccgcgccttctcggcgctctacccggagacgattttgctggtcgacacctacgac
acgctcgacggcgtgcgcaaggtaatcgacctgatgaacgagacaggcgacgaggtgcag
gtgcgcggcatccggctcgactcgggcgaccttgcggagctggcccgctcctcccgtacc
ctgctcgacgaggccggccttgccgacgtcatgatcttcgccagcggggggctcgacgag
cacacgatcgcggacctcctcgaccgcggcgcccccatcgacggcttcggggtcggcacc
cggatgggcacgtccgccgaccagcccgccctcgataccgcctacaagctatccgggtac
gccgggacgccccgcatgaagctcgcccccgagaagtcgaacctaccggggcgaaagcag
gtcgtccgccagtacgaggacggcacggccgtccgggacgtcatcgcgaccgaggacgag
cagacgaacggggcgccgctgctggaacgcgtcatggccgacgggaagcggaccgaggcc
ggggccccgcgtcccctgtcggcaatccgggagcacgcggcggcgcggctggacgagttg
ccgtctcgcctccgcgctcccaccgccaacccggaggactacgacgtcgttctcagcgac
gccctggagaaacgggtcgcggacacccgcgacgccctggcggaaacgatggccgccgaa
gccgcgtag

DBGET integrated database retrieval system