KEGG   Salinibacter ruber DSM 13855: SRU_0462Help
Entry
SRU_0462          CDS       T00312                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sru00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SRU_0462 (mutM)
Enzymes [BR:sru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SRU_0462 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SRU_0462 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
618307..619104
Genome map
AA seq 265 aa AA seqDB search
MPELPDAVVYRRRLADAALDRPIADATVVDPLILGDGLEPHRLGEVLRGRTLTDTHRHGK
HVFVRYGEETGWLALHFGMTGRVQVVPDGTMPEYAYVQVHFEDGGALAFECPRKFARVRL
VDTPDAFVEAKDLGPDARRADVDAFLAPFASRRGAIKGRLLDQSVVAGLGNIYADEALYQ
EGIHPRTTVPELSETDLRGLYDAIQRVLDAAIAVDADPEALDPDRFMLPHRYGDEHCPKT
GVPLDTETVSGRTAYFSPTRQSPPK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgacgccgtcgtctaccggcggcgccttgccgacgcggccctcgac
cgcccgattgccgacgccacggtcgtcgatccactgattctcggcgacggcctggagccg
catcgcctcggagaggtgctccggggccgcacgctgaccgacacccaccgccacggcaag
cacgtcttcgtccggtacggggaagagaccggctggctcgccctccacttcggcatgacc
ggacgtgtgcaggtcgttccggacggcacgatgcccgaatacgcgtacgtccaggttcac
tttgaagacgggggcgccctggcgttcgagtgcccgcgcaagtttgcccgcgtgcgcctc
gtcgacacgccggacgcgtttgtcgaggcgaaagacctcggccccgacgcgcgccgcgcc
gacgtcgatgcttttctggcgcccttcgcgtcccgccgcggtgccatcaaaggccggctg
ctggaccagagcgtcgtggcgggcctcggcaacatctacgccgacgaggccctctaccag
gagggcatccacccgcgaacgaccgtgccggagctctccgagaccgacctccgcggcctc
tacgacgcaattcaacgggtcctggacgccgccatcgcggtcgacgccgaccccgaggcc
ctggacccggaccgcttcatgctgccccaccgctacggggacgagcactgcccgaagacc
ggcgtgcccctcgacaccgagaccgtctccggccgcacggcctacttttcccccacccgc
cagtcgcccccgaagtag

DBGET integrated database retrieval system