KEGG   Salinibacter ruber DSM 13855: SRU_0590Help
Entry
SRU_0590          CDS       T00312                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sru00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sru00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
774130..774690
Genome map
AA seq 186 aa AA seqDB search
MTVSETSLPGVRLIEPDVYTDDRGSFAELWNVRDYGHHGLDVTFVQDNLSRSREGVLRGL
HFQNPRAQGKLISVLEGAVYDVVVDVRAGADTFGAWEGQVLSAENARQLYVPEGYAHGFV
ATSGEVLFHYKCTDFYHPEADRTVRWDDPALGIDWPTEDPILSEKDAGAPALDEIPREAL
RFDDVR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtttctgagacctcccttcccggcgtgcgcctgatcgagccggacgtctacacg
gacgatcgcggctcgttcgccgagctgtggaacgtgcgggactacggccaccacggcctt
gacgtcacgttcgtgcaggacaacctgtcccggtcccgcgaaggggtactgcgggggctg
cacttccagaacccccgggcgcaggggaagctgatttcggtgctggagggtgccgtctac
gacgtggtcgtcgacgtgcgggcgggggcggatacgtttggagcgtgggaggggcaggtc
ctctcggccgagaacgcgcggcagctgtacgtgccggagggctacgcccacggcttcgtg
gcgacgagcggcgaggtcctcttccattacaagtgcaccgacttctaccacccggaggcc
gaccggacggtccggtgggacgacccggcccttggcatcgactggccaacagaagacccg
atcctgtcggagaaggatgcgggggcgcctgcgctggacgaaatcccccgcgaggccctt
cggttcgacgacgtgcgatga

DBGET integrated database retrieval system