KEGG   Salinibacter ruber DSM 13855: SRU_0689Help
Entry
SRU_0689          CDS       T00312                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SRU_0689 (ispE)
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SRU_0689 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(896446..897417)
Genome map
AA seq 323 aa AA seqDB search
MSPRAPLPTRRRRRHGKTGGQPKSTLLRAFSLCPAPPRSMPLAQDAPAKINLGLHVLRRR
PDGYHDIETVLHRIDWADTITATPADTLSLTCSDPSLPTDRDNLCLQAAHRLASACDVPA
GADLHLEKRVPYGAGLGSGSSDAAATLRLLARLWDVDPTSETLQEIGRTIGADVPFFLQD
APAAYATGRGDTLSPLSKDGASYRLPFSLLIAVPSAEIATPWAYDRVTPAEANRPDLRRL
VLSNDLSRWDEALTNDFAPPVTTAIPAVDAARTALRATDAACVSLSGSGSAVYGLFEETA
AARAALQSLKPRDLRTHLMPAPN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgcgcgcccccctgccgactcgcaggcgtcgtaggcacgggaagacaggaggg
cagcccaaatctacactgcttcgcgcgttttctctctgccccgcccctccccggtcgatg
cccctcgcccaagatgccccggccaagatcaacctgggcctccacgtcctccgtcggcgc
cccgacggataccacgacatcgaaacggtcctgcaccggatcgactgggccgatacgatt
acggcaacgcccgccgacaccctctccctcacatgctcggacccgtcgcttcccacagac
agggacaacctgtgcctccaggcggcccaccggctcgcgtcggcgtgtgacgtacccgca
ggcgccgacctccacctcgagaagcgggtgccgtacggcgccggcctgggcagtggatcc
agcgacgccgcggccacactccggctccttgcgcggctgtgggacgtggacccgacctcc
gaaaccctccaggaaatcgggcgcacgatcggggccgacgtgccgttttttctccaggat
gcgccggccgcctacgccaccggacgcggcgacacgctttcgccactttccaaagacggc
gcatcgtaccggctgccgttttccctgctcatcgccgtgccgtccgccgagatcgccacc
ccttgggcctacgaccgggtaacccccgcagaggccaaccggcccgacctacggcgtctc
gtgctttcgaatgacctgtctcgctgggacgaagcgctcaccaatgacttcgcccccccg
gtgacgacggccataccggcggttgacgcggcgcgcacggccctgcgggcgacagacgcg
gcctgcgtctctctctccgggtccggcagtgccgtgtacgggcttttcgaagagacggcc
gcagcccgggcggcccttcagtcactgaagccgcgggacctccgaacccacctcatgccg
gcgccgaactga

DBGET integrated database retrieval system