KEGG   Salinibacter ruber DSM 13855: SRU_0710Help
Entry
SRU_0710          CDS       T00312                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sru01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sru00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sru00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sru00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sru00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sru00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(920073..921140)
Genome map
AA seq 355 aa AA seqDB search
MNALVYDDFDAPLTLRTVSRPTPTPRGVVLQVLACGVCRSDWHGWKGHDPMITPPNVPGH
EVVGIVTAVGDRVEEWSGGERVTVPFVGGCGTCAQCRAGQHQVCPHQFQPGFSAPGAFAE
YVGIDYADENLVRLPGSIDAVTGASLGCRFATAFRAVVDQGAVRSGEWVAVHGCGGVGLS
AVMIAQAAGARVVAVDVADPALALADEVGASRTINADDTENVAAAVREATRGGAHLSLDA
LGSPDTCRNSVANLRTHGRHVQVGLLMGEHARTAIPFDRVVADELEVRGAHGLQAHRYPA
LFNMIETGRLHPRQLVRQTISLPEAADRLRQMGDFAGTGIAVIDDFGGGRTQAEV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccctcgtctacgacgattttgacgcgcccctgacgctccggacggtttcacgg
cccacccctacgccgcggggcgtcgtgctgcaggtgcttgcgtgtggggtgtgccggagc
gactggcacggctggaaggggcacgacccgatgatcaccccgccgaacgtgccggggcac
gaggtcgtggggatcgtgacggcggtcggggaccgtgtagaggagtggtctgggggggag
cgcgtgacggtgccgttcgtgggcggctgcggcacatgcgcccagtgccgcgccggccag
catcaggtgtgcccccatcagtttcaacccggcttttcggccccgggggccttcgccgag
tacgtgggcatcgactacgccgacgagaacctggtccgccttccggggtcgatcgacgca
gtcaccggggcgagcctcggctgccgcttcgccaccgccttccgggccgtggtcgaccag
ggagcggtgcgcagcggcgagtgggtggccgtccacgggtgcggcggcgtgggcctgtcg
gccgtcatgattgcccaagccgccggcgcccgggtcgtcgcggtggacgttgccgatccg
gccctcgcgctcgccgacgaggtgggggccagccgcacgatcaacgccgacgacaccgag
aacgtggccgccgccgtccgcgaggccaccaggggcggcgcccacctctccctcgacgcc
ctgggcagcccggacacgtgccgcaactccgtagcgaacctgcgaacgcacggccggcac
gtccaggtcggcctcctgatgggcgagcacgcacgcaccgccattcccttcgaccgcgtg
gtggccgacgagctggaggtgcgcggcgcacacggcctgcaggcccaccgctatccggcc
ctcttcaacatgatcgagacgggccgcctccatccccgtcagctcgtccggcagacgatc
tcgcttccggaggcggccgatcgcctgcggcagatgggcgacttcgccggcacgggcatc
gccgtgattgatgacttcgggggaggcaggacgcaggcagaggtgtga

DBGET integrated database retrieval system