KEGG   Salinibacter ruber DSM 13855: SRU_0811Help
Entry
SRU_0811          CDS       T00312                                 

Definition
2-oxo acid dehydrogenase acyltransferase catalytic subunit
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_0811
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRU_0811
  Amino acid metabolism
   00310 Lysine degradation
    SRU_0811
Enzymes [BR:sru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SRU_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1031637..1033556)
Genome map
AA seq 639 aa AA seqDB search
MGVIPYIGSPSTRRLPGSPPRILTARHTTEIMAQVDVEMPKMGESITEGTVIAWHKQPGD
EVEQDEILLEIGTDKVDTEVPSPKGGVLTETLVEEGDTVEVGTIIATLDTDTAAAEVDAD
DEPPAEAPSDDEAAADEAKEAAPDADAEDEAEATPPETDSEEAASPAPSGDEVEVVMPKM
GESITEGTVVAWYKDIGEAVAIDETILEIGTDKVDTEVPSPAEGVLTEKLVEEGETVEVG
TVVALLASEAEAGSVEPPASDEPDTTQETAPEADEAELPSTPPSGDGAVPDADEPQRAPE
ETITRRGDDGRFYSPLVRSIAKEEGLRMSELESLEGSGRGGRVTKEDVLAYLDEREEAPA
APASAPERPPRPGRSDEAPPARGDYTVDEGPSDEELRQQYGDRIEVQPMDRMRKMTAEHM
VRSKATSAHVTSFAEADVTGLVQLREANKEAFREREGVKLTYTPFFVKAAVEALREHPLL
NASVEGDKIVIKHDFHVGIAVAIGNKGLLAPVIRNAGDYNVSGLARKAANVAERARNKEL
QPDELQGGTFTVTNIGSLGSLMGTPIINQPQVGILATGAIQKRPVVVENDGLGDAISVRH
MMYLSLSYDHRIIDGAMGSSFLQRVVTELESFSADADLF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcattccctacattggaagtccttccacacggcgtctccccggatcgccacca
cgcattctcactgcacggcacacgaccgaaatcatggcacaagttgacgttgaaatgccc
aagatgggcgagagcattaccgaaggcaccgtcattgcctggcacaagcagcccggcgac
gaggtggagcaggacgagattctgctcgaaatcgggaccgacaaggtcgatacggaagtg
ccctcccccaagggcggcgtgctcacggagacgctcgtcgaggagggcgacacggtggag
gtgggaaccatcatcgcaacgctagacaccgacacagcagccgcggaggtggacgccgac
gacgagccccccgccgaggcgccgtccgacgacgaagcggccgcggacgaggcgaaagag
gccgctccggacgcggacgccgaggatgaggcggaggcgacgcccccagagacggattca
gaagaagctgcgtctccggccccctccggcgacgaggtggaggtcgtgatgcccaagatg
ggcgagagcattaccgagggcaccgtcgtcgcctggtacaaggacatcggcgaggcggtc
gccatcgacgagaccattctggagattggcaccgacaaggtggacacggaggtgccctcc
cccgccgagggcgtgcttaccgagaagctcgtcgaggagggcgaaaccgtcgaggtcggc
acggtcgtggccctcttggcctcggaggcggaggccggatcggtggagccccccgcgtcc
gacgagcccgacaccacgcaggagacggcccccgaggccgacgaggcggagctgccctcc
acgcccccctccggcgacggggcggtgcccgacgccgacgagccgcagcgcgcccccgag
gagacgattacgcgccgcggcgacgacgggcgcttctactcgcccctcgtgcgctcgatc
gcgaaggaggaagggcttcgcatgagcgagctggagtcgcttgagggctccggccggggc
ggtcgcgtgacgaaggaggacgtgctcgcctacctcgacgaacgcgaggaggcccccgcg
gcccctgcatccgcccccgagcggccgccgcgccccggtcgttcggacgaggcccccccc
gcccgcggcgactacacggtcgacgagggcccgagcgacgaggagctgcgccagcagtac
ggcgaccgcatcgaggtgcagcccatggaccggatgcgcaagatgaccgccgagcacatg
gtgcggtcgaaagccacgtccgctcacgtcacctccttcgccgaggccgacgtgacgggc
ctggttcagctccgggaggccaacaaggaggcctttcgggagcgcgagggcgtgaagctg
acgtacacgcccttcttcgtgaaggccgcggtggaggcgctccgcgaacatcccctgctc
aacgcgagcgtggagggcgacaagattgtcatcaagcacgacttccacgtcggcatcgcc
gtggccatcggcaacaagggcctcctcgccccggtcattcgcaacgcgggggactacaac
gtgtcggggctggcccgcaaggcggcgaacgtggccgaacgggcccgcaacaaggagctc
cagcccgatgagctgcagggcggcaccttcacggtcaccaacatcggctcgctcggctcc
ctgatgggcacgcccatcatcaaccagccgcaagtgggcatcctcgccaccggggccatt
cagaagcggccggtcgtcgtggaaaacgacggcctcggcgacgccatctccgtgcgccac
atgatgtacctttccctcagctacgaccaccgcattatcgacggcgccatggggtccagc
ttcctgcagcgcgtggtgacggagctggagtccttttccgcggacgcggacctgttctaa

DBGET integrated database retrieval system