KEGG   Salinibacter ruber DSM 13855: SRU_0811Help
Entry
SRU_0811          CDS       T00312                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
sru00020  Citrate cycle (TCA cycle)
sru00310  Lysine degradation
sru01100  Metabolic pathways
sru01110  Biosynthesis of secondary metabolites
sru01120  Microbial metabolism in diverse environments
sru01130  Biosynthesis of antibiotics
sru01200  Carbon metabolism
Module
sru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SRU_0811
  Amino acid metabolism
   00310 Lysine degradation
    SRU_0811
Enzymes [BR:sru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SRU_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PTS_EIIA_1 HlyD_3 AATase
Motif
Other DBs
NCBI-GeneID: 3851338
NCBI-ProteinID: YP_444947
UniProt: Q2S4D4
Position
complement(1031637..1033556)
Genome map
AA seq 639 aa AA seqDB search
MGVIPYIGSPSTRRLPGSPPRILTARHTTEIMAQVDVEMPKMGESITEGTVIAWHKQPGD
EVEQDEILLEIGTDKVDTEVPSPKGGVLTETLVEEGDTVEVGTIIATLDTDTAAAEVDAD
DEPPAEAPSDDEAAADEAKEAAPDADAEDEAEATPPETDSEEAASPAPSGDEVEVVMPKM
GESITEGTVVAWYKDIGEAVAIDETILEIGTDKVDTEVPSPAEGVLTEKLVEEGETVEVG
TVVALLASEAEAGSVEPPASDEPDTTQETAPEADEAELPSTPPSGDGAVPDADEPQRAPE
ETITRRGDDGRFYSPLVRSIAKEEGLRMSELESLEGSGRGGRVTKEDVLAYLDEREEAPA
APASAPERPPRPGRSDEAPPARGDYTVDEGPSDEELRQQYGDRIEVQPMDRMRKMTAEHM
VRSKATSAHVTSFAEADVTGLVQLREANKEAFREREGVKLTYTPFFVKAAVEALREHPLL
NASVEGDKIVIKHDFHVGIAVAIGNKGLLAPVIRNAGDYNVSGLARKAANVAERARNKEL
QPDELQGGTFTVTNIGSLGSLMGTPIINQPQVGILATGAIQKRPVVVENDGLGDAISVRH
MMYLSLSYDHRIIDGAMGSSFLQRVVTELESFSADADLF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtcattccctacattggaagtccttccacacggcgtctccccggatcgccacca
cgcattctcactgcacggcacacgaccgaaatcatggcacaagttgacgttgaaatgccc
aagatgggcgagagcattaccgaaggcaccgtcattgcctggcacaagcagcccggcgac
gaggtggagcaggacgagattctgctcgaaatcgggaccgacaaggtcgatacggaagtg
ccctcccccaagggcggcgtgctcacggagacgctcgtcgaggagggcgacacggtggag
gtgggaaccatcatcgcaacgctagacaccgacacagcagccgcggaggtggacgccgac
gacgagccccccgccgaggcgccgtccgacgacgaagcggccgcggacgaggcgaaagag
gccgctccggacgcggacgccgaggatgaggcggaggcgacgcccccagagacggattca
gaagaagctgcgtctccggccccctccggcgacgaggtggaggtcgtgatgcccaagatg
ggcgagagcattaccgagggcaccgtcgtcgcctggtacaaggacatcggcgaggcggtc
gccatcgacgagaccattctggagattggcaccgacaaggtggacacggaggtgccctcc
cccgccgagggcgtgcttaccgagaagctcgtcgaggagggcgaaaccgtcgaggtcggc
acggtcgtggccctcttggcctcggaggcggaggccggatcggtggagccccccgcgtcc
gacgagcccgacaccacgcaggagacggcccccgaggccgacgaggcggagctgccctcc
acgcccccctccggcgacggggcggtgcccgacgccgacgagccgcagcgcgcccccgag
gagacgattacgcgccgcggcgacgacgggcgcttctactcgcccctcgtgcgctcgatc
gcgaaggaggaagggcttcgcatgagcgagctggagtcgcttgagggctccggccggggc
ggtcgcgtgacgaaggaggacgtgctcgcctacctcgacgaacgcgaggaggcccccgcg
gcccctgcatccgcccccgagcggccgccgcgccccggtcgttcggacgaggcccccccc
gcccgcggcgactacacggtcgacgagggcccgagcgacgaggagctgcgccagcagtac
ggcgaccgcatcgaggtgcagcccatggaccggatgcgcaagatgaccgccgagcacatg
gtgcggtcgaaagccacgtccgctcacgtcacctccttcgccgaggccgacgtgacgggc
ctggttcagctccgggaggccaacaaggaggcctttcgggagcgcgagggcgtgaagctg
acgtacacgcccttcttcgtgaaggccgcggtggaggcgctccgcgaacatcccctgctc
aacgcgagcgtggagggcgacaagattgtcatcaagcacgacttccacgtcggcatcgcc
gtggccatcggcaacaagggcctcctcgccccggtcattcgcaacgcgggggactacaac
gtgtcggggctggcccgcaaggcggcgaacgtggccgaacgggcccgcaacaaggagctc
cagcccgatgagctgcagggcggcaccttcacggtcaccaacatcggctcgctcggctcc
ctgatgggcacgcccatcatcaaccagccgcaagtgggcatcctcgccaccggggccatt
cagaagcggccggtcgtcgtggaaaacgacggcctcggcgacgccatctccgtgcgccac
atgatgtacctttccctcagctacgaccaccgcattatcgacggcgccatggggtccagc
ttcctgcagcgcgtggtgacggagctggagtccttttccgcggacgcggacctgttctaa

DBGET integrated database retrieval system