KEGG   Salinibacter ruber DSM 13855: SRU_0825Help
Entry
SRU_0825          CDS       T00312                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SRU_0825 (pfkA)
   01230 Biosynthesis of amino acids
    SRU_0825 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SRU_0825 (pfkA)
   00030 Pentose phosphate pathway
    SRU_0825 (pfkA)
   00051 Fructose and mannose metabolism
    SRU_0825 (pfkA)
   00052 Galactose metabolism
    SRU_0825 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SRU_0825 (pfkA)
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SRU_0825 (pfkA)
Protein phosphatases and associated proteins [BR:sru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SRU_0825 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1047272..1048354)
Genome map
AA seq 360 aa AA seqDB search
MVWWWRALGPSGEGQPGPLPSSLFPVIDPSRPTMQDIECLGVYTSGGDAPGMNACLRAVV
RTAIANDIAVMGIRRGYEGMIEADFVEMERRSVSNILQSGGTILKSARSEAFRTEEGRRA
AANSLRENGIDALVAIGGDGTFRGASKLYDEHGLGVVGCPGTIDNDLYGTDQTIGYDTAL
NTAIDNIDRIRDTADAHNRLFLVEVMGRDAGFIALNSGIGGGAELILIPETITEMDMVKE
RILSLMTAQRRSTIVVVAEGDELGGAQGIERALRDDAAFSDIELRSTILGHTQRGGAPTA
SDRVLASRLGVAAVESLMDGHSDVMVGMTNNEIKLTPLRNVYGRRKSIDYDLLKLTQILS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
ttggtatggtggtggcgcgccctcggcccgtccggtgagggccagcccgggccgctgcct
tcttctcttttccccgtcatcgacccctctcgaccgaccatgcaggacatcgagtgcctc
ggcgtgtacaccagtggcggcgacgccccgggcatgaacgcgtgcctccgggccgtcgtc
cgcacggccatcgccaacgacattgcggtgatgggcatccgtcgggggtacgagggcatg
atcgaggccgacttcgtggagatggagcggcgctcggtctccaacatcctccagtcgggc
ggcacgatcctcaagagtgcccggtcggaggcctttcgcaccgaggagggacgccgggcg
gcggccaacagcctccgcgagaacggcatcgacgccctcgtggccattgggggggacggc
acgtttcggggggcctcgaagctctacgacgaacacgggctcggggtggtgggctgcccg
ggaaccatcgacaacgacctgtacggcaccgaccaaacgatcgggtacgacacggccctc
aatacggccatcgacaacatcgaccgcatccgcgatacggccgacgcccacaaccggctg
ttcctcgtggaagtgatggggcgggacgccgggtttattgccctcaactccggcatcggg
ggcggggcggagctgatcctgatccccgaaaccatcacggagatggacatggtaaaggag
cgcatcttgtccctcatgacggcccagcggcgctccaccatcgtggtcgtggccgagggg
gacgagctgggcggggcccagggcatcgagcgcgcgctgcgggacgacgcggccttctcg
gacatcgagctccgctccaccattctcggccacacgcagcggggcggggccccgacggcc
agcgaccgggtcctggcgagccgcctcggcgtagccgccgtcgagtccttgatggacggc
cattcggatgtgatggtgggcatgaccaacaacgagatcaagctcacgcccctccgcaac
gtctacggccggcgcaagtcgatcgactacgacctgctgaagctgacgcagattctgagc
taa

DBGET integrated database retrieval system