KEGG   Salinibacter ruber DSM 13855: SRU_0829Help
Entry
SRU_0829          CDS       T00312                                 

Gene name
dfrA
Definition
dihydroflavonol 4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
sru  Salinibacter ruber DSM 13855
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1050649..1051683
Genome map
AA seq 344 aa AA seqDB search
MTPTEDRRRSMASSHSVLVTGATGFVGSVLTRQLVDAGTDVRIFRRDTSSLDLLGTYAER
VDHAVGDLRRARSLYEAMQGVDRVYHVAAKVSFARGDRAAVRRVNADGTAHVVNAALKAG
VDRLVHTSSIAALGRPPEPDGAIDETTEWQGLPHRSAYARSKRRAELEVHRGIAEGLDAT
LVNPSLVFGVGGPETNTRRIVDAVRSGWLLAVPPGGTNVVDVRDVAAGLRAAMQKGETGR
RYFLGGENLSWRTLATTLADEFGVAPPRYTIPPSLLRVGGMLAEGVAALTRTQPVLARTT
ARTAARTYRYDNSRARAELGCTFRPFAETARRVAAVLSGDAPTP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccaccgaagaccgtcgtcgatccatggcttcttcccattctgttctcgtcacc
ggcgccaccggcttcgtcggctccgtcctcacccgccagctcgtcgatgccgggaccgac
gtgcgcatcttccggcgcgacacctcgtccctcgacctcttgggcacgtacgccgagcgg
gtcgaccacgcggtgggcgacctccggcgggcccgaagcctgtacgaagcaatgcagggg
gtcgaccgggtctaccacgtggcggccaaggtgagttttgcgcggggcgaccgggcggcc
gtccggcgcgtcaacgcggacggcacggcccacgtcgtcaacgccgccctgaaggccggg
gtcgaccggctcgtgcacacctccagcatcgcggccctgggccgcccgccggagccggac
ggggcgattgacgagacgaccgagtggcagggcctgccccaccgctccgcctacgcccgg
tccaagcgccgggccgagttggaggtgcaccgcggcatcgccgaagggctcgacgcgacc
ctcgtcaacccttcgctcgtcttcggggtgggcgggcccgagaccaacacgcgccgcatc
gtcgacgcggtgcgcagcggctggctgctcgccgtgccgccgggcgggaccaacgtggtg
gacgtgcgtgacgtggcggcgggcctgcgggcggcgatgcagaagggcgagacgggccgt
cgctacttcctagggggagagaacctgtcgtggaggacgctcgccacgacgctcgcggac
gaatttggggtggcgccgccccgctacacgattccgccgtcgcttctacgagtcgggggc
atgctggccgagggcgtcgccgccctcacccgcacgcagccggtcctcgcacgcaccacg
gcccgaaccgccgcccgcacctaccgctacgacaacagccgtgcccgcgccgagcttggg
tgcacgtttcggccctttgcggagacggcccgacgcgtcgctgccgtgctgtccggggac
gccccgacgccgtag

DBGET integrated database retrieval system