KEGG   Salinibacter ruber DSM 13855: SRU_0846Help
Entry
SRU_0846          CDS       T00312                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SRU_0846 (glgB)
Enzymes [BR:sru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SRU_0846 (glgB)
Exosome [BR:sru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRU_0846 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1079966..1081834)
Genome map
AA seq 622 aa AA seqDB search
MPHLTDDDIYYWRQGTHTHSYERMGAHPNQRGTWFGVWAPNADRVEVTGDFNDWRFGADV
LDRREGGLWEGYVRGAQPGDKYKYHLRAGGEWFDRTDPYAFRMEPPAQNTYEGLSALITD
LDTYTWGDDAWMTTREGPSGIDGPLSIYEVHLGSWRHEEHGASLSYREVAEPLADHVQNL
GFTHVEFLPLAEHPYYGSWGYQILGYYAPTFRYGDPEGLMHLIDTLHQRGIGVIMDWVPG
HFATDPQGLTYFDGSHLFEYEDPLMREHPDWGTRVFDFGKNGVRNFLLSNALFWMDKYHV
DGLRVDAVASMLYRDYSREGDWSPNVHGGRENLGAISLLQDTNEHVYDEYPEAIMLAEES
TAWPGVTTPTEHGGLGFLYKWNMGWMHDTLEYASKEPVHRKHHHGDLTWTLSWAFSENYT
LPLSHDEVVHGKNSLWSKMPGDDWQKAANLRLLYAHMFGHPGKKLLFMGGEFGQHREWDH
DRALEWDLADEPLHEGLMEWLGDLNHLYQNAPALWNDQEDGFEWIAYDDRENSVLTYRRL
NGDRSLVFVLNFTPVVREDYRIGATGDGRWHERLNSDSDVYGGSNVGNRGAVHSDPVEKH
GHSHSLSLTLPPLGALVLEPAE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgccccatctcaccgacgacgacatctactactggcggcaaggcacccatacccacagc
tacgaacggatgggggcgcaccccaaccagcggggcacctggtttggcgtctgggccccc
aacgccgaccgggtggaagtgacgggcgactttaacgactggcgcttcggggccgacgtg
ctggaccgacgcgagggcgggctctgggagggctacgtccgcggcgcccagccgggcgac
aagtacaagtaccacctccgggccggcggcgagtggttcgaccgcaccgacccctacgcc
ttccgcatggagccgcccgcccagaacacctacgagggcctctcggccctcatcaccgac
ctcgacacctacacgtggggcgatgacgcctggatgaccacccgtgagggccccagcggg
atcgacgggccgctttccatctacgaggtgcacctcggctcctggcgccacgaggagcac
ggcgcgtcgctcagctaccgggaggtcgccgagccgctggccgaccacgtgcagaacctc
ggcttcacccacgtcgagtttctgcccctcgccgagcacccgtactacgggtcgtggggc
taccaaattctcgggtactacgcccccaccttccgctacggcgaccccgaaggcctcatg
cacctcatcgacacgctgcaccagcgtggcatcggggtcatcatggactgggtgcccggc
cacttcgccaccgacccgcaggggctcacctacttcgacgggtcccacctcttcgaatac
gaggacccgctcatgcgggagcatccggactggggcacgcgcgtgttcgacttcggcaag
aacggcgtgcgcaacttcctgctctccaacgccctcttctggatggacaagtaccacgtg
gacggcctgcgggtcgacgcggtcgcctccatgctctaccgcgactactcccgggagggc
gactggtcgcccaacgtgcacggcggccgcgaaaacctgggcgccatcagcctcctccaa
gacaccaacgagcacgtctacgacgagtaccccgaggcgatcatgctggccgaggagtcg
accgcctggcccggcgtcaccacccccaccgagcacggcggcctcggcttcctctacaag
tggaacatgggctggatgcacgacacgctcgagtacgcgagcaaggagccggtccaccgc
aagcaccaccacggcgacctgacctggaccctcagctgggcgttctccgaaaactacacg
ctccccctctcccacgacgaggtggtgcacggcaaaaactccctgtggagcaaaatgccg
ggcgacgactggcagaaggcggccaacctgcggctgctctacgcccacatgttcggccac
cccggcaagaagttgctcttcatgggcggcgagttcggacagcaccgcgagtgggaccac
gaccgggcgctggaatgggacctcgccgacgagccgctgcacgagggcctgatggagtgg
ctcggcgacctcaaccacctctaccagaacgcaccggccctctggaacgaccaggaggac
ggcttcgaatggatcgcgtacgacgaccgcgagaacagcgtcctcacctaccgccgcctc
aacggggaccggtcgctcgtctttgtgctcaactttaccccggtcgtccgcgaggactac
cgcatcggggccacgggggacggccggtggcacgagcggctcaatagcgacagcgacgtg
tacggcgggagcaacgtgggcaatcggggcgccgtccacagcgatccggtcgagaaacac
gggcactctcactctctgtcgttgacccttcccccgctgggagcattggtcttggaaccg
gccgagtag

DBGET integrated database retrieval system