KEGG   Salinibacter ruber DSM 13855: SRU_0955Help
Entry
SRU_0955          CDS       T00312                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SRU_0955 (folK)
Enzymes [BR:sru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SRU_0955 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1221778..1222332
Genome map
AA seq 184 aa AA seqDB search
MSSAYLGLGSNEGDRLEHLQRAAERLQQRDALTVVGVSPVYETEAHTTSPDETQPPFLNA
VLRLTVEADPRSLLRMAHAVEQAEGRTRTAEQRWGPRPLDVDLLAVGPLTRDTEALTLPH
PRLAERRFVLRPWADLAPNFVVPPPFDRSVQSLLDQCTDPASIRRTDHTIGEGRASPEAP
GTET
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttctgcgtatttggggcttgggtccaacgagggcgaccgcctggagcacctgcag
cgggcggccgagcggctgcaacagcgcgacgccctcaccgtggtgggcgtctcccccgtg
tacgagaccgaggcccacacgacctcgccggacgagacgcagcctccgtttttgaacgcc
gtgcttcggctgaccgtcgaggccgacccgcgttccctcctccgaatggcgcacgcggtg
gagcaggcggaggggcgcacccggaccgcggagcagcggtgggggccccgcccgctggac
gtcgacctactggcggtcggacccctcacccgagacaccgaggccctcacgcttccccat
ccgcgccttgcggagcgccggttcgtgctccgcccctgggccgacctcgcgccaaacttc
gtcgtcccgccgccgttcgaccgctctgtgcaatcactgctcgatcagtgcacggatccg
gcttccattcgacggacggatcacacgattggggagggacgagcctcccctgaagccccc
ggtacggagacgtaa

DBGET integrated database retrieval system