KEGG   Salinibacter ruber DSM 13855: SRU_0980Help
Entry
SRU_0980          CDS       T00312                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SRU_0980
   00051 Fructose and mannose metabolism
    SRU_0980
Enzymes [BR:sru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SRU_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1250984..1252126)
Genome map
AA seq 380 aa AA seqDB search
MSDPSLHSLCRWTFHEGTGRFVPSGVRPAWGPDQFDTVDFVRLVQDEVAPRLPEHVELGV
ELHYDNEYNEENAADIADALDATGLSLAMVTPGAHLHYAYGGIASLDPDEREAAEAFSRR
SVELAYGPLRPGWNDDPAKAPSLVVWNGSFGYDLATPELRRMYQNLKESLATLCQFEAEQ
GGALFIALEPKPNEGHPALLLPTVASAIVMWYRIADEFDVSLDRKGINKEIGHSEMVGLD
PVHDTIEELDNGMMHHTHLNSQGYNDGISMGGPGRFDIDQAARINGLNIAMARLMQDAGF
DRWKGHDVQARPYDDTRQALGRAVRSILSWEACEHAARKLDADLLHDFLAGRETAQAEDL
MREAVVSAQHWFDDHFEPIA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacccttcgcttcacagcctctgccgctggaccttccacgagggcacgggccga
ttcgtcccgagcggcgtccgcccagcctgggggccggaccagttcgacaccgtcgacttc
gtccgtctggtacaagatgaagtggcgccgcgcctgcccgagcacgtggagctgggcgtg
gagctgcactacgacaacgagtataacgaggagaatgcggcggacatcgccgacgccctg
gacgcaacgggcctgagcctggcaatggtgacaccgggggcccacctgcactacgcctac
ggcgggatcgcgtcgctcgaccccgacgagcgcgaggcggccgaggcgttttccaggcgc
agcgtcgagcttgcctacggccccctccgccccggctggaacgacgacccggccaaggcc
ccctccctcgtcgtgtggaacggctccttcgggtacgacctcgccacccccgagctgcgg
cggatgtaccagaacctgaaggaaagcctggcgacactgtgccagtttgaggcggagcag
ggcggggccctcttcattgccctggagccgaagcccaacgaagggcacccggccctgctc
cttcccaccgtggcgagcgccatcgtcatgtggtaccgtatcgcagacgagttcgacgtg
tccctggaccggaaaggcatcaacaaggagatcggccactccgagatggtgggcctcgac
cccgtgcacgatacgatcgaggagctcgacaacgggatgatgcaccacacccacctcaac
agccagggctacaacgacggcatctcgatgggcggccccgggcggttcgacatcgaccag
gccgcccgcatcaacggactgaacatcgccatggcccgcctcatgcaggacgccggcttc
gaccgctggaagggccatgacgtgcaggcccgtccatacgacgacaccaggcaggccctg
ggccgcgcggtgcgtagcattctcagctgggaggcctgcgagcacgccgcccgaaagctc
gatgccgacctgctgcacgacttcctcgccggccgggagacggcccaggccgaagacctg
atgcgcgaggccgtcgtgtcggcccagcactggttcgacgaccacttcgagccgatcgcg
tag

DBGET integrated database retrieval system