KEGG   Salinibacter ruber DSM 13855: SRU_1013Help
Entry
SRU_1013          CDS       T00312                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sru00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1293212..1294234)
Genome map
AA seq 340 aa AA seqDB search
MASSDYDLPLRPRRLRKTRNIRRMARETRLSTDDLIAPLFVMAGDNQREEVPSMPDTYRH
TIDRLVDHAETLHALGIPAVALFPALPDHLKTPDAEHALDPDHLYPNAIRVLKDAVPELM
IITDTALDPYNSDGHDGIVRDGRIDNDATIQVMCEMAVLHAEAGADIIAPSDMMDGRVGA
LRAALDDAGHTDAAILSYTAKYSSNYYGPFRDALDSAPEDKAEAPEKDIPANKDTYQMDP
ANGEEAIRELMLDLDEGADMAMVKPALPYLDVIHRVQQHSDVPVAAYNVSGEYAMIKAAA
QNGWLDEKACALEALTGIRRAGADVILTYFAEDAARWLEE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccgactacgaccttcccctccgcccccgtcgactgcgcaagacccgcaac
atccgacgcatggcgcgggagacacggctgtcgacggacgacctcattgcgcccctgttc
gtgatggcgggggacaatcagcgggaagaagtcccgtcgatgccggacacgtaccgtcac
acgatcgaccggctcgtcgaccacgcagagacgctgcatgcccttggcattccggcggtg
gccctgttcccggccctccccgatcacctgaagacgccggacgccgagcacgccctcgac
cctgatcacctctacccaaacgcgatccgggtcctcaaggacgccgtgccggaactgatg
atcatcaccgacacggccctcgatccctacaacagcgacgggcacgacggaatcgtgcgc
gacggccgcatcgacaacgacgcgaccattcaggtgatgtgcgaaatggcggtgctccac
gccgaggccggggccgacatcatcgccccatccgacatgatggacgggcgcgtgggcgcc
ctccgcgctgccctcgacgacgccgggcacaccgacgccgcaatcctgtcttacaccgcc
aagtactcgtcaaactactacggcccgttccgcgacgccctcgactcggcgcccgaggac
aaggcggaggcccctgagaaggacatccccgcgaacaaggacacctaccagatggacccg
gccaacggcgaggaggccatccgcgagctcatgctcgacctggacgagggcgccgacatg
gcaatggtgaagccggcgcttccctacctcgatgtcatccaccgcgtgcagcagcacagc
gacgtgcccgtcgccgcgtacaacgtgagcggcgagtacgccatgatcaaggccgccgcc
caaaacggctggctcgacgagaaggcctgtgcactggaggccctcaccggcattcgccgc
gccggggccgacgtcattctgacctacttcgcggaggacgcggcccgctggctggaagaa
tga

DBGET integrated database retrieval system