KEGG   Salinibacter ruber DSM 13855: SRU_1013Help
Entry
SRU_1013          CDS       T00312                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sru  Salinibacter ruber DSM 13855
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SRU_1013 (hemB)
Enzymes [BR:sru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SRU_1013 (hemB)
Exosome [BR:sru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SRU_1013 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1293212..1294234)
Genome map
AA seq 340 aa AA seqDB search
MASSDYDLPLRPRRLRKTRNIRRMARETRLSTDDLIAPLFVMAGDNQREEVPSMPDTYRH
TIDRLVDHAETLHALGIPAVALFPALPDHLKTPDAEHALDPDHLYPNAIRVLKDAVPELM
IITDTALDPYNSDGHDGIVRDGRIDNDATIQVMCEMAVLHAEAGADIIAPSDMMDGRVGA
LRAALDDAGHTDAAILSYTAKYSSNYYGPFRDALDSAPEDKAEAPEKDIPANKDTYQMDP
ANGEEAIRELMLDLDEGADMAMVKPALPYLDVIHRVQQHSDVPVAAYNVSGEYAMIKAAA
QNGWLDEKACALEALTGIRRAGADVILTYFAEDAARWLEE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccgactacgaccttcccctccgcccccgtcgactgcgcaagacccgcaac
atccgacgcatggcgcgggagacacggctgtcgacggacgacctcattgcgcccctgttc
gtgatggcgggggacaatcagcgggaagaagtcccgtcgatgccggacacgtaccgtcac
acgatcgaccggctcgtcgaccacgcagagacgctgcatgcccttggcattccggcggtg
gccctgttcccggccctccccgatcacctgaagacgccggacgccgagcacgccctcgac
cctgatcacctctacccaaacgcgatccgggtcctcaaggacgccgtgccggaactgatg
atcatcaccgacacggccctcgatccctacaacagcgacgggcacgacggaatcgtgcgc
gacggccgcatcgacaacgacgcgaccattcaggtgatgtgcgaaatggcggtgctccac
gccgaggccggggccgacatcatcgccccatccgacatgatggacgggcgcgtgggcgcc
ctccgcgctgccctcgacgacgccgggcacaccgacgccgcaatcctgtcttacaccgcc
aagtactcgtcaaactactacggcccgttccgcgacgccctcgactcggcgcccgaggac
aaggcggaggcccctgagaaggacatccccgcgaacaaggacacctaccagatggacccg
gccaacggcgaggaggccatccgcgagctcatgctcgacctggacgagggcgccgacatg
gcaatggtgaagccggcgcttccctacctcgatgtcatccaccgcgtgcagcagcacagc
gacgtgcccgtcgccgcgtacaacgtgagcggcgagtacgccatgatcaaggccgccgcc
caaaacggctggctcgacgagaaggcctgtgcactggaggccctcaccggcattcgccgc
gccggggccgacgtcattctgacctacttcgcggaggacgcggcccgctggctggaagaa
tga

DBGET integrated database retrieval system